(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE406

PENCW_13.PE406       Location/Qualifiers
FT   CDS_pept        join(923691..924232,924414..925371,925422..925535)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160991" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947723"
FT                   /orf_name="Pc16g04060"
FT                   /product="Pc16g04060 protein"
FT                   /function="tetracycline:hydrogen antiporter activity "
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP93076.1"
FT                   /db_xref="GO:0015520"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831404"
FT                   /db_xref="UniProtKB/TrEMBL:B6H867"
FT                   /transl_table=1
FT                   /translation="MKMDPIPSHPESSPNSPTPTSDRSFLQTFTILTALCAGVFVAALD
FT                   VTIITTALPSIAAHFESSSAYTWIGSSYILANTATIPAWGKVSDIWGRKPLLLVATVIF
FT                   FSGSLICAVGNTIAIFLFGRAVQGLGAAGLITLVNICVSDLFSLRDRGLYFGLISVVWA
FT                   LASGVGPVLGGVFTEKASWRWCFWVNLPVTGLVFLLLWLTLKLESPDTPIWSGLKAVDW
FT                   TGCLFVIGSTIMLLLGLDFGGVSHPWNSATVICLIIFAGVLLGLFVVNEWRLAKYPVIP
FT                   LVLFHHRSGIASFLVCFCHGYIFMGEAYYLPLYFQAVLSSSPIMSGVYIIPFVLALTVS
FT                   AALTGFFIQKTGVYVPAMWSGLAAMTLGVGLLINLEVTANWGKIMGFQVIAGIGIGMNF
FT                   EGPLLALQAIVGSENTATATATIGFVRTLSTAISVVIGTVVFQNQMARKESQLVSTLGQ
FT                   QLASQVSRDAMANIKVIDTLPLDQKLVARQAIYGSLQTVWIMYVAFAAVGLVAGVFVEG
FT                   HHLDTEHKAPVLGLRDDNEG"
     atgaaaatgg acccgatccc ttctcaccca gagtcaagcc cgaactcccc aaccccgacc        60
     tcagatcgat cgtttttgca aacatttacc attctgactg ccctatgtgc aggagtattt       120
     gtggctgctc ttgatgtcac tattattacg acagccttgc cgtcgattgc cgcacatttt       180
     gagtctagtt ccgcctacac atggatcggc agttcctaca tcctggccaa cacggccacc       240
     atacccgcct ggggtaaggt ttcagatatc tggggccgaa agccgttgct actagtggcg       300
     acggtaattt ttttcagtgg aagtttgatc tgcgcagtcg gaaatacgat cgcaatattc       360
     ctgtttggtc gggccgtcca ggggctagga gcggccggtc tgatcaccct cgtgaatatt       420
     tgtgtcagtg acttgttctc tcttagagat cgtggcctgt attttggcct catttctgtc       480
     gtatgggccc tcgccagtgg agtaggtcca gtcctcggtg gggtgttcac tgaaaaagca       540
     agttggcgct ggtgtttttg ggtcaatctc ccagtcactg gactagtctt cttgttatta       600
     tggcttactc tcaagcttga atcacccgat accccaatat ggagcggcct gaaggctgtc       660
     gactggacgg gatgtttgtt cgtcatcggt agcaccatca tgcttttgtt gggtctcgac       720
     tttgggggtg tctcgcaccc ttggaactcc gccacggtga tatgtctcat catctttgcc       780
     ggcgtgcttc taggtctgtt cgttgtcaac gaatggagac tggcgaagta ccccgtcatt       840
     ccactagtcc tattccatca tcgctccggt atcgcttctt tcttggtctg tttttgccat       900
     ggctacatct ttatgggcga agcatattat ctcccgctat acttccaggc ggtcctcagc       960
     tctagtccga ttatgtctgg ggtttacatt attccgtttg tcttggctct caccgtttca      1020
     gctgcattaa ctggattttt tattcaaaag acaggagtat atgtcccagc gatgtggtcg      1080
     gggctagccg ctatgacgtt gggggtgggt ttgctgatca acctcgaggt taccgccaac      1140
     tggggcaaaa tcatgggttt ccaggtcatt gccggcatcg gcatcggtat gaattttgag      1200
     ggcccattgt tggcactcca agcaattgtt gggtccgaga atacagcaac tgccactgcg      1260
     accattggat tcgtacggac cctgtccacc gcgatctcgg tcgtcatcgg aaccgtcgtg      1320
     ttccagaatc agatggcaag aaaagaatcc caattggtct ccaccctggg ccagcaacta      1380
     gccagtcaag tctcaagaga cgcaatggct aacatcaagg tcatcgatac actccccctg      1440
     gatcaaaagc tcgtggcacg acaggccatt tacgggtcat tgcaaacggt ctggatcatg      1500
     tacgttgcat ttgcagccgt ggggctagta gcaggggtat tcgttgaggg ccatcatctg      1560
     gacacggagc acaaggcacc ggtgctcggt ttacgagatg ataatgaagg ctga            1614
//

If you have problems or comments...

PBIL Back to PBIL home page