(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE407

PENCW_13.PE407       Location/Qualifiers
FT   CDS_pept        complement(925609..926549)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947724"
FT                   /orf_name="Pc16g04070"
FT                   /product="Pc16g04070 protein"
FT                   /function="RNA binding"
FT                   /protein_id="CAP93077.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI00018314E8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H868"
FT                   /transl_table=1
FT                   /translation="MASEASTSANGGSLAAMLEQQHARDEAHKATVEETVDEEDLKHPP
FT                   PTSLQPEEPLLVNSDTSEPTTIAQTASPTPSPKPPTKKAPTFDVQSEELFPALGSGPKP
FT                   AAPAAATWGAKKPSAAATVANGSPASQWVRGLFWSPPGVGQISDTGTEIPRIMALPGKH
FT                   MEQLRLAPSQMQPRGQMKKPLRDILRDISRRSKANVDMRGGPGGSIIFEGKGSVDAVRQ
FT                   ALREVAQQQSVRVPIPTSARAHIIGRQGTVVQDIQTRTGARVQVPRADGNAADDDDDDT
FT                   IDILIEGDAVAAEMARREIEAIVKERGSNMSFRLKTVPPEFFPFIAGAHDANLRAIEER
FT                   TKAQINVPRYDTWSTQPPPQEANPGQVQFVAVPDKHILISGERAAAQEARAEIERLAAQ
FT                   LRQQLTLRQLAINRGQHQFILGNEPDALHQFVAQTGCAIVLPPSSDESEFLTITGPVDQ
FT                   IEAGIEHAMDLATSMQMASIDLSRQHPNAPAGPHAHASALSQYLRRRQVIKELESTYDA
FT                   HIALPPSVGGPVTWEVYSRDGKNTIRARSDIMNLVQALPPSRLRHVSVDPYFHQYLRDR
FT                   SATTLQGDYGVHLMVPDDVNCPEVVLVYEGPSSTASSFEVPRQRPSPADVAAFEKGLQE
FT                   AQEYLLGALGDQRDIVAKSVSVPAKYQEKARKFINREQEAKGEDSIPVRAIVGDAKGSQ
FT                   CQVSLRGPSGLVAELAAKVEAFVVEQEKDDLERGYTTSFDFPQKYANFLIGKRGENINK
FT                   LREEFDVDIKVENGKVEVKGPKAKADATRMRIINMGKKLEDETTHILKVPAQYHRELIG
FT                   QRGNQVNRLQDRYSVRVQFPRATVPNDDATETGSDAGGARPQRAQQAPDEVLVKGPSKG
FT                   ADSARDEILSLLQYVIEHGHSASISVAQSQVASLIGQRGREMEKLRADTGAQIDVPNAN
FT                   DAPDASGRVEIRVKGTKQQVAEAKKILQQRASEFDATVTKTIEVEKKYHKALIGGGGAN
FT                   IRKIVTEAGGPTDGSAARMVRFPRPESTESTIRLEGNGKIVDNIIAAIEEFVKERQDQV
FT                   TEILDVPTAQHRMLIGRGGEARRGIETKFNVTLDIPKQGSGRTDVKLKGPSSAVQSAKE
FT                   HIQSMLKEQHAETIEVPSHLHHFLADNGQIFRRLRNDYQVTVDHAGQAVPVPAPSAAED
FT                   TRTTAEGTDMPLIIDDPNVTADAHSWTVVDNNATEVPSSPFPWVLSGTPENVAKARAVI
FT                   EKNLASATQQSTTGYLILPDPKTYRFVVGQGGSQINAIRKKTGCRINVPKEQARGEAIE
FT                   IRGSPSGLEEAKEMILEAVQNGLHPSAR"
     atgaattcgc tcaagagctt ctggactcaa tacttcccgc cttcgccaac gtcgagcgaa        60
     tcacaggttg gcccccaact actccgtgta ttcgtggtca ctggaggaaa ctcaggctta       120
     ggcctggaac tagtcaaacg actttaccct acaggtgcaa caatctattt ggcctgtcga       180
     tccaaggaac gcgcggagat agccatgcag aaggttattg aatccaccaa tgaatcatac       240
     atcagcacac ctcccaaact caaatttctg tatctggact tgaatgattt atcgtccatt       300
     gccaaatcag ccgctacctt ttgcaaaaat gagtcacggc tggatatcct gtggaataat       360
     gcaggaattg gcgggagtcc cattgggact acaacccggc agggccttga gggtcatatt       420
     ggggtaaact gtgttggccc cctaatgttc acccaggccc ttcttccaat gctacgcaat       480
     gcagctcagg atagcgcccc ggaagtgtgc ggatcgtttg gactgccagt ttgagtatcg       540
     agtcacatgc tcctgttggg ggcattaggc cagatcgagt ggattgcggg atcacgcaag       600
     atcctcctag cgactacgct caatcaaagg tcggaaactg gtggttggcg ctagaaggtg       660
     cgagacggta tgcagagtac ggaattgtga gcgttgccca aaacccggga cagctggata       720
     cagatgtgtg gaagcatcag ccatggtggt tgatgattct ggtgcgaccc acattgtatg       780
     ataagagatt cggagtctat acgatgttgt acgcagggtt ctccaaagtt ctgctggttg       840
     gagataaacg atacgtgatt ccatggggcc gagtaagaga gtggaatgaa tgtccgccga       900
     gggatattgt agcggctatg gatgatatgg gtccggaatg a                           941
//

If you have problems or comments...

PBIL Back to PBIL home page