(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE408

PENCW_13.PE408       Location/Qualifiers
FT   CDS_pept        join(927092..927273,927413..927840,927888..928419,
FT                   928475..929192,929244..929348,929401..929930)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947725"
FT                   /orf_name="Pc16g04080"
FT                   /product="Pc16g04080 protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="CAP93078.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="InterPro:IPR000375"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="InterPro:IPR020850"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="UniParc:UPI00018314E9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H869"
FT                   /transl_table=1
FT                   /translation="MAVVSTLKLPSQGLGDPVLLDKIDQLLACNLAGYVNLPQLVVVGD
FT                   QSSGKSSVLEGLTKLPFPRDSGLCTRFATHIIFRRTRADTKRSISASIVPAYGKPAEHA
FT                   SRLGAWKATHMESLDSESFASTMREVHETMGLSRSREESSKPTFTLDVFRLDICGPEED
FT                   NLSIIDVPGIFKNTTHGLTTKQDMDLVKDMVLSYMRNPRSIMLTVIPANVDIATQEILE
FT                   MARECDPEGSRTQGVFTKPDLVDKGAEDKVIDLVEGKTSSLKLGWIVVRNAGQQQLLDQ
FT                   DSNRDEVESQFFREAHPWNNLPKDKVGIASLKIRLQEVQTTQILESFPRHMRAEVGRKL
FT                   KAMKQDLSALGIERSTPEQQRNFLLDIIVKFQNIVSQAMATSYGTHELFEKDEDTRLAT
FT                   IVRNRMDVFKSDMEEYGFEYQFLNWAPALHAGVGPVPEPESGSGDDSDDDDDEEADGIP
FT                   VRKNMNTSEHSGAIDGILHEQVNVRKPRGGSILAWIEDQYRASRGFELGTFQTALLCTI
FT                   MNKQSDKWTELALGYVSDVIDIMHTFILKVLLSICPDEQIRDKLLNVLVDELSKRYRAA
FT                   MDQAQMILEVERMNLMTLDDKFQQTLDIAQKRRCVRLIHSISGEDTILNYFTSHQEQYE
FT                   IVKGKEKVPMSNTQQTVRYIHDILAAYYAVASKRFIDSICMQATGYCLLTGPRKPPGLF
FT                   SPQFVADLAEDQLMEIAGENARLSRRRVQLKKGIQDLETGRKIMM"
     atgggggtca gacacatctc gctgttctta gccaacattc ttcttcctgc tgcggtgatc        60
     ctctttggtt gtgggctttt ctcgtccgag ccaactggga ttatcacacc atatgcgtac       120
     aaggagaagg caccaccact ctttgacaag gttgtgttca tggttattga tgctcttcga       180
     agtagtttca gcctgatcag gtcaggctcg gcgattccat ttactgcgca tgcaaaccct       240
     ccgagtctta ctatctcgtg catcaaagca atgacaattg ggtcgaaccc atcttttctg       300
     gacgtcgcgc tcaatattgc cgacaatgat gatgcatcta atctttctag tgaggatacc       360
     tggctgcaag gtttaaaagc accactcgcg gaaagataat attctacggc gaaaacacgt       420
     ggttgcagct gtacccggac atttttgatc ggagtgaggg tgttgacgca ttcttcgtgc       480
     cagactttac tgaagtcgac aataatgtta caattcatgt ctctccaaaa ttagctcgtg       540
     aagactggtc cgcactggta tttcacttcc caggaatgga ccatatcggc cataccggcg       600
     gaccagagag tccctatata cttcggaagc aacaagagat ggactttatc atccgtgaga       660
     tatatacagc catcgaatcc cagcctcatc tcagttcgac cctcttcgtc gtagctggcg       720
     accatggcat gaaccaacaa gggaatcacg gtggatcttc cgcgggtgaa atctccccag       780
     ggatgctcct gatttctcct gatttgaaat cgctccctag cgacagagaa gctccaactg       840
     cccctcatgg cacaggattt gacttttatt ctgtcattaa acaacctgat atcgtcccca       900
     cgctggccgg tctgctcggc tttcgaatcc ctagcaagag cgagggagtt ttcatgccac       960
     aactcctctc cctttgggaa gacccatctg atcgtgtacg gctattatta gagaacgctc      1020
     atcaactact gaatgttagg ggacaccatg tcgatcaccc gtatcacatc tctcttcaaa      1080
     gaattgaaga tcgaattgtt tcggatccaa gctcaacgga agccttgtcg gaattatacc      1140
     agtggtgtta tcaaatgcag aactcattgg gcatggcagc tggaagtcta aactttcgtc      1200
     tgctctccgc aggccttttg agcgcagtca gcgctagcat cttatgcctc agtgtcctct      1260
     tcaatgggca cctcgaagtc aaacacatgg ttgtgtcaac ggtatttgcc gcagtctaca      1320
     ccggagctat gctttccgag aaatatgtca cgcaagaaca taacttctgg tacccggtct      1380
     ctctgatctg gtttggctat cttagctact ctagggactg taactgcagc cctttcgatc      1440
     gtgcgcttcc agtcctagtg caatttttgg ttctgtcctg gacgcaaagt ggagatgcaa      1500
     ccgatatgct gccaaaaata tttcagacgt tcctttcccg gtaccccctg atcctctgga      1560
     taatgttgag ttgggcttat gtttccactt ccgtccggct gtatggatca ctgggaagtg      1620
     catgtggctc caccatcgtt cccaaaatat gggctacgtc tctcggcgcc ctggcactct      1680
     tactgaagtt cggttctgct tctctcaata cccctgacct agttagattc acctctccgc      1740
     atctccttta ctggttagcg caggtaaatt tgaactccac tgccaaactg gtcttctcaa      1800
     tattggcggg cactctggtt tacttgctaa cactgaaggg caaatgtaaa cgaacgaaag      1860
     aacttgccgg cattcatcat gtcctcgcca tttacataat ggcgcagtcc agacctcgga      1920
     atattccttt gttcctggtt ttccaatggc agctgaaatg gttgatttta gcaccctcaa      1980
     cttattctgt cttcgagatt gctttgtcca ccatcatctt gtcccaaagc tctttcttta      2040
     catttggtgg tagcaacacc atcgcttcgg tcgatttaac aaatggctac aatggtgtca      2100
     cgtcttacaa ttcaattgcg gtggtactgc agacgctttt cgccaattgg gcaggtccta      2160
     tctggtgggc ctgcgcggga ataaggttac tcgagatcac cattcaccac agagcatctc      2220
     aagtcctatc tccgaagaaa agcgatcagg aagacaagaa gagggtcgga aagcccagtt      2280
     caacattgat ggcttatttg gctattcaga cactgtttat ttccatcagt cttgctgcta      2340
     tcatggttgc atgtgttgtt ctttgggatt catccatgat ctggacagct ttagctccca      2400
     agtatatttt cgccggttta tgggtggtct tctatcacgt gtttgtcacc gttggactat      2460
     ttggtgctgt tggaaaagca gtacttgcga attga                                 2495
//

If you have problems or comments...

PBIL Back to PBIL home page