(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE409

PENCW_13.PE409       Location/Qualifiers
FT   CDS_pept        join(complement(931075..931226),complement(930572..930995))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201304" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824351"
FT                   /orf_name="Pc16g04090"
FT                   /product="Pc16g04090 protein"
FT                   /protein_id="CAP93079.1"
FT                   /db_xref="UniParc:UPI00018314EA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H870"
FT                   /transl_table=1
FT                   /translation="MSLLRKPMKQYNWLPDYMQNIYQWLYYCEPTWGYTIYRTTYTPQS
FT                   NAAFPAANEFNITPWDEIWPNYQPRVIEDASRFDGASIDQLRKHFRADAIERDMLDVFP
FT                   SYRMFIVIDEESFQTLRNAPFPENSKYEERRYHYVKLVEALEVDLSEDFQGWMKCSLPS
FT                   LWEIWSDMQDTTYMKDTSSMIPDDTDVL"
     atgtcgctac tccgaaagcc gatgaagcaa tacaactggc ttccagatta tatgcaaaac        60
     atctatcaat ggctctatta ctgtgagcct acctggggct ataccatcta ccggacgacc       120
     tacactcccc aatccaatgc cgcttttccc gcggcaaatg agttcaatat cactccctgg       180
     gatgaaatct ggcctaatta ccagccacgg gtaattgaag atgcttcccg gttcgacgga       240
     gcatcgatag accagctccg caagcatttt agggccgatg caattgagcg tgatatgctc       300
     gatgttttcc ctagctatcg tatgtttatt gtcattgacg aagaaagctt tcaaacctta       360
     cgaaacgctc cctttccaga gaactcgaaa tacgaagaga ggagatatca ttatgtgaaa       420
     ctcgtcgagg cgttagaggt agatctatct gaggatttcc aagggtggat gaagtgctcc       480
     ctgccctcgt tgtgggaaat ttggtcggat atgcaggaca cgacttatat gaaggacact       540
     tcttcgatga tacccgacga taccgatgtt ttgtga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page