(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE410

PENCW_13.PE410       Location/Qualifiers
FT   CDS_pept        join(931746..932170,932259..932895)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000207761" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128692"
FT                   /orf_name="Pc16g04100"
FT                   /product="Pc16g04100 protein"
FT                   /biological_process="mitochondrial proton-transporting ATP
FT                   synthase complex assembly"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAP93080.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0033615"
FT                   /db_xref="InterPro:IPR007849"
FT                   /db_xref="UniParc:UPI00018314EB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H871"
FT                   /transl_table=1
FT                   /translation="MWKYTLSTLVADLPLLQTGRCLSCQFRNPATLSQLRTKPFSLRQY
FT                   SNKPGKPIDAKETPPVKRNLKNEAHRLSTAIEFKQNQPQDGPQPGDADFVPPSLDRPIG
FT                   SPQAPLEGQNTGIDTRSMRQRRDDFTNYDRHIKRRKELTKQVAKPYFREWSNLRFAEGK
FT                   TFVSNPRLFKADRALYFPNMHGITLASPKDPQNTTTQLRGSISVVNLFSSVWAESQVAT
FT                   FTGPEQNPGLVEAMASGGKLVQRIDINLEENRLKAFLVKTFMWRMRQKLAKEQHSRYFL
FT                   VQKGFDQALKETVGMMNSKVGYVYLVDSECRIRWAGSGPAEKSELEGLNAGVRKLIEEK
FT                   KNVLRVHDPSRGY"
     atgtggaaat acaccctctc caccttggtg gccgaccttc ccctcctgca gaccggccgc        60
     tgtctaagct gccaattccg caacccagca actctctccc agctacgaac caaacccttt       120
     tctctgcgcc aatattctaa taagcccggg aaacccatcg atgcaaaaga aaccccgccc       180
     gtgaaacgaa acttaaagaa cgaggcacac cgcctatcga ctgccatcga attcaaacag       240
     aaccagcccc aggatggacc ccagcccggc gacgcagact tcgttcctcc aagcctggac       300
     cggccgatcg gtagcccaca agcaccatta gaaggacaga acacaggtat tgacacgcgg       360
     tcgatgcgcc agcggcgcga cgacttcacc aactatgacc ggcatataaa gcgccgcaag       420
     gaattgacaa aacaagtcgc caagccatac ttccgcgaat ggtccaatct ccgcttcgcc       480
     gagggcaaga cctttgtctc gaacccgcgg ttgttcaaag ccgacagagc cctttacttc       540
     cctaatatgc acggcataac actggcatca cccaaggatc ctcaaaatac gacgacccag       600
     ctgcgcggca gcatctccgt cgtaaacctg ttctcaagcg tgtgggccga gagccaagtt       660
     gcgacgttta cagggccgga gcagaatcca ggacttgtgg aggcgatggc cagcggtggt       720
     aaactggtgc agaggatcga tatcaatctc gaagagaacc ggttaaaggc gtttctggtg       780
     aagacgttca tgtggcggat gcggcagaaa ttggccaagg agcagcattc gcgttacttc       840
     cttgtgcaga agggcttcga tcaggcactc aaggagaccg ttggcatgat gaattcaaag       900
     gtcggctatg tctacctggt cgattcggag tgccgcatcc gctgggcggg gagtggaccg       960
     gctgagaagt ctgagttgga gggacttaac gctggtgtac ggaagcttat tgaggagaag      1020
     aagaatgtcc tccgagtgca cgatccgtct cgcgggtatt ga                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page