(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE411

PENCW_13.PE411       Location/Qualifiers
FT   CDS_pept        join(complement(933952..934017),complement(933782..933895),
FT                   complement(933211..933714))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207760" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824352"
FT                   /orf_name="Pc16g04110"
FT                   /product="Pc16g04110 protein"
FT                   /protein_id="CAP93081.1"
FT                   /db_xref="UniParc:UPI00018314EC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H872"
FT                   /transl_table=1
FT                   /translation="MASSTSSGWTQLRQQARSLETQTENLFHTYSQFASITKPPPSPTE
FT                   EELRLESQLKDLLERRESVIAQLSRLLDSEATLTSSALKQNNVSRHREVLQDHRRELQR
FT                   LTAAISESRDRANLLSNVRSDISSYRASNPAAAEAEYMLEERGRVENSHSMMDGVLSQA
FT                   YAINENFGVQSETIANINRRIVGAAGNVPGMNYLIGKIGNKKRRDAIILGCFIGFCFLM
FT                   LLFFR"
     atggcatcct caactagttc cgggtggacg cagctccggc aacaagcacg gtcgcttgaa        60
     actcagaccg agaacctttt ccacacctat tcacaatttg cctcgattac caaacctcca       120
     ccatcgccta ccgaggaaga gctgcggctt gaatcgcaat tgaaagacct cctcgaaaga       180
     cgcgagtctg tcatcgccca actatcccgt ctcctcgact ccgaagccac cctcacctcc       240
     tccgctctaa aacagaataa tgtctcccga caccgcgaag tgcttcaaga ccaccgccgc       300
     gaactccaac gtctgaccgc agctatttcg gaatcgcgtg accgtgcaaa cctactctct       360
     aatgtccgct cagacatcag ctcctatcgc gcatccaacc ctgccgccgc cgaggccgag       420
     tacatgctcg aagagcgggg ccgagtcgag aacagccaca gcatgatgga cggcgttctg       480
     agccaggcgt atgccatcaa tgagaacttc ggtgtccaga gcgagacgat tgctaacatt       540
     aatcggcgca ttgtcggcgc tgctggaaat gttcccggca tgaactatct catcggcaag       600
     attggaaaca agaagaggcg ggatgctatc attctcgggt gtttcattgg gttctgcttt       660
     ttgatgttgc tgttcttccg gtaa                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page