(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE415

PENCW_13.PE415       Location/Qualifiers
FT   CDS_pept        join(complement(943794..943946),complement(943526..943659),
FT                   complement(942854..943382))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207717" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947729"
FT                   /orf_name="Pc16g04150"
FT                   /product="Pc16g04150 protein"
FT                   /function="sequence-specific DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP93085.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI00018314F0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H876"
FT                   /transl_table=1
FT                   /translation="MPPRKSASSVTPADPDDSLLQQSPPVPQSEKPVFATEQQLKARAE
FT                   AGASVEDYLLPRSLTVRLAKSVLPPNTTIQKDAVLAMQKAATVFVSYLSSHANDATLKR
FT                   TIAPSDVFNALSELELDSFRGRLEQELEAYTEIKAGKRKPKKADDNGSTQDALGEGATQ
FT                   GDGDVDMVDNPAKKVKRDEDVEVAVGPPAGDDGDETQEEDVEEEEEEEEESEDDEEEEH
FT                   APREDDLEHVEDLDREPGAKKGPYDPDAEETDEDEDGPGGQLRDDLGLG"
     atgccacctc ggaaatccgc gtcctcagtt acgcctgctg atcccgatga ttccctactg        60
     cagcagtcgc ctccagtacc gcagagcgag aagcccgtct ttgcgacaga gcagcagttg       120
     aaggctcggg ccgaggcggg cgcaagtgtc gaggactatc tcctaccacg ctcactgacg       180
     gttcgtctcg ccaagtcggt tctcccaccg aatactacga tccagaagga tgccgtgttg       240
     gctatgcaga aggctgctac ggtgtttgtt tcctacttgt cttcacatgc caatgatgca       300
     accctcaaac gcaccatcgc cccatcagac gtcttcaacg ccctctccga gctagaactc       360
     gactctttcc gcggcagact tgaacaggaa ctggaggcat acacggaaat caaagccggg       420
     aagcgcaagc cgaagaaggc ggatgataat ggctcgacgc aggatgcatt aggcgagggt       480
     gcgactcagg gtgatggtga tgtcgacatg gtcgataatc ctgcgaaaaa ggtgaagcgg       540
     gacgaagatg tggaggtagc tgttggtccg cctgctgggg atgatgggga cgagactcaa       600
     gaggaagacg tcgaagagga agaggaagaa gaggaggaaa gtgaggatga tgaggaggag       660
     gaacatgctc cgcgtgagga tgatcttgaa catgtggagg atttggatcg tgagcctggc       720
     gcgaagaaag ggccttacga tcccgatgcc gaggagacgg atgaagatga ggatgggcct       780
     ggtggtcagt tgcgggatga tcttgggttg ggctaa                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page