(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE416

PENCW_13.PE416       Location/Qualifiers
FT   CDS_pept        join(complement(946179..946200),complement(946020..946114),
FT                   complement(944447..945958))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207716" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671670"
FT                   /orf_name="Pc16g04160"
FT                   /product="Pc16g04160 protein"
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP93086.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR014813"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="UniParc:UPI00018314F1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8E8"
FT                   /transl_table=1
FT                   /translation="MVTKSGFGKTSKRVPVRLRHKIEKSAVQKQRKQRKLAKKNPEWRS
FT                   KIKKDPGIPNLFPNKDKLLHDIEERKRIKAEEQQRIREEARARKAEGLPAKAGTEAVDI
FT                   DENDMMDDDMDAEGNDSNPMAALLASARARAVEYDDNQSEDEDMEEDEDDDDDEMDEDE
FT                   EEGGATIDESAPPLVNSKSYSKESSRRQFDKVFKQVTDNADVVLYVLDARDPEGTRSKD
FT                   IEREIMMADGGNKRLILILNKIDLVPPPVLKGWLLHLRRSFPTLPLKASSGTTANAHSF
FT                   DHKQLTVKGTSDTLFRALKSYAGAKQLKRAISVGVIGYPNVGKSSVINALTARLNKGSS
FT                   NACPTGAEAGVTTSLRQVKLDSRLKLIDSPGIVFPSSSDKSGKKNKKQEEQARLILLNA
FT                   VPPKQIEDPVPAVNLLMKRLSSSENLLAKMLELYGITALFPTNGDKTTDFLVQVARKRG
FT                   RLGKRGVPNIESAAMTVINDWRDGRIQGWANAPVLPVVSADAPAGDVEAGVDTTKVAVV
FT                   TEWAKEFSIEGLWGNGQGDDEEMAE"
     atggttacta agagtggctt cggcaagact tccaagcggg ttcccgtccg ccttaggcat        60
     aagatcgaaa agtctgccgt ccagaagcag agaaagcaaa ggaagctcgc aaaaaagaac       120
     cccgaatggc ggtcaaagat caagaaggac ccgggcattc ccaatctctt ccccaacaag       180
     gataagctcc tccacgatat cgaagagcgg aagcgcataa aggccgagga gcaacagcgt       240
     attcgtgagg aggcacgagc ccgcaaggct gaaggcctgc ccgcgaaggc tggcactgag       300
     gctgtcgata tcgacgagaa cgacatgatg gatgatgata tggatgccga gggcaacgat       360
     tcgaatccaa tggctgctct tctcgcttca gcacgcgccc gtgccgtaga gtacgatgat       420
     aaccaaagcg aggacgagga catggaggaa gatgaagacg acgacgacga tgagatggac       480
     gaggatgagg aggagggcgg tgcaactatc gatgaatctg ccccgccatt ggtcaattca       540
     aagtcttact caaaggagag ctcacgacgc caattcgaca aggtgttcaa gcaggtcacc       600
     gacaacgctg atgtcgtgct ttacgtgctc gatgcccgcg accccgaggg cacccgctcc       660
     aaggatattg agcgcgaaat tatgatggca gatggtggca ataagcggtt gattcttatt       720
     ttgaacaaga tcgatctggt tccgccccca gtactcaagg gctggttgct tcacctgcgc       780
     cgctccttcc ccactctccc ccttaaggca tccagcggta ccactgccaa cgcacacagc       840
     ttcgaccaca agcagttgac agtcaagggt acttcggata cgctcttccg tgccctcaag       900
     tcatacgctg gcgccaagca gttgaagcga gccatctctg tcggtgtcat tggatacccc       960
     aatgtgggca agtcgtccgt tatcaacgca ctcactgcac gtctgaacaa gggctcgagc      1020
     aatgcatgcc cgacaggcgc cgaggctggt gtcaccacta gcctgcgcca ggtcaagctg      1080
     gacagcaggc tcaagctgat tgactcgcct ggaatcgtct tccccagctc cagtgataag      1140
     tctggcaaga agaacaagaa gcaagaagag caggcgcgtc tgattctcct caacgctgta      1200
     ccacccaagc agatcgagga tcccgttccc gcggtcaacc tcctgatgaa gcgtctatcc      1260
     tcatcggaga acctcctcgc caagatgctc gagttgtacg gcatcaccgc acttttcccc      1320
     acaaatggcg acaagactac cgacttcttg gtccaggtgg cccgcaagcg cggccgtctc      1380
     gggaagcgtg gtgtgcccaa catcgagagc gctgctatga ccgttatcaa cgactggaga      1440
     gatggccgca tccaaggctg ggccaatgca cccgtgcttc ctgtggtctc ggcggatgct      1500
     cctgccggcg atgttgaggc tggcgtcgac acaacaaagg tcgcggtcgt caccgagtgg      1560
     gccaaggagt tcagtatcga gggtctctgg ggcaacggac aaggtgatga cgaggagatg      1620
     gccgagtaa                                                              1629
//

If you have problems or comments...

PBIL Back to PBIL home page