(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE417

PENCW_13.PE417       Location/Qualifiers
FT   CDS_pept        join(946589..946688,946766..946787,946853..946962,
FT                   947030..947511)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248341" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947730"
FT                   /orf_name="Pc16g04170"
FT                   /product="Pc16g04170 protein"
FT                   /function="phosphoglycolate phosphatase activity "
FT                   /protein_id="CAP93087.1"
FT                   /db_xref="GO:0008967"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006402"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00018314F2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8E9"
FT                   /transl_table=1
FT                   /translation="MSSTTGSFSAPTQVHTFDGLLSDFDGTIVDSTDAIVKHWHKIGDE
FT                   LGVDPKVILATSHGRRSIDVMGLYDQTKANWDYVNEIEGRIPKEFGTDAVEIPGGRDLI
FT                   AALETSGARWGVVTSGTRPLVDGWLEVLGLPHPKNLVTAMDVPLGKPDPRCYLLGRKQL
FT                   GIEESTSIVVLEDAPSGIKAGKAAGFKVIALTTTHSLQKLQEAGADWIVEDLRSLSVKA
FT                   VVDGQVQIEIRNAYQ"
     atgtcctcaa caacaggatc attctctgcg cctacgcagg tccacacatt cgatggtctt        60
     ctttctgact tcgatggcac aattgtcgac tccactgatg caattgtgaa gcactggcac       120
     aaaattggcg acgagctcgg cgtcgacccc aaggttatcc tcgcgacctc tcatggccgc       180
     cgcagcatcg atgtaatggg tctatacgac cagaccaagg ccaactggga ctatgtcaat       240
     gaaatcgagg gccgcatccc gaaagaattt ggcaccgacg ccgtcgagat ccccggcggt       300
     cgcgacctca tcgcagccct cgagacctca ggcgcaagat ggggtgttgt aacatccggc       360
     acgcgccctc tagtcgacgg ctggctggaa gttctcggtc tcccacaccc caagaacctg       420
     gtgacagcaa tggacgtgcc gctcggcaag ccagacccgc gctgctacct tctgggccgg       480
     aagcagcttg gcatcgaaga gtcgacctcg attgtcgtac tcgaggatgc accgtctggg       540
     atcaaggctg gtaaggctgc tggtttcaag gtgattgcgt tgacaacgac gcattcgctg       600
     cagaagcttc aggaggctgg cgcggattgg attgtggaag atttgaggag cctttcggtc       660
     aaagctgttg tggatggcca ggttcagatc gaaatcagga atgcgtacca atag             714
//

If you have problems or comments...

PBIL Back to PBIL home page