(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE418

PENCW_13.PE418       Location/Qualifiers
FT   CDS_pept        join(947783..947843,947951..948073,948149..948200,
FT                   948246..948501,948573..948905)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977577"
FT                   /orf_name="Pc16g04180"
FT                   /product="Putative uncharacterized protein Pc16g04180 "
FT                   /protein_id="CAP93088.1"
FT                   /db_xref="UniParc:UPI00018314F3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8F0"
FT                   /transl_table=1
FT                   /translation="MSTVWSYSWKLRTVATGAENAGLDAPRPQALGSAYPEMVKGYKVL
FT                   KQLSWFPGRGCNRTRQGMEFTAALHTDRRMTADSCIAVDTVTGRPRAPWHAWRTPFVGM
FT                   QLRNPCSSKPDFFDRALQHATVPATHIWSNHLGRAGRELPFMHAWDMEPDREHGNVSPE
FT                   KLYGGETTAAAASSFGKGVRCSRGYGYSFVPATLEQQHSADVIGGSSGLGDGHILPDWG
FT                   SLGRERMFSPMVLRKATRPVRTACKGATLHPAHESREEVMFECRLLNIVTID"
     atgtctaccg tctggtcgta ttcctggaag ttgaggaccg tagcgactgg tgctgaaaat        60
     gcggggctag atgctccccg accgcaagca ctaggctctg catatcctga aatggtaaaa       120
     ggatacaaag tcttgaagca gctcagctgg ttccccgggc ggggatgtaa tcggaccagg       180
     caaggtatgg agttcaccgc agctttgcac acggatcggc gaatgacagc tgacagctgt       240
     atagctgttg acacggtaac tggacgccct agagcaccat ggcatgcgtg gcggacacct       300
     ttcgtaggta tgcagctacg caatccttgc agctcaaagc cggatttctt cgacagggcg       360
     ttacagcatg caactgtacc tgctactcac atctggtcca atcatttagg cagggcgggc       420
     cgcgaactac cgttcatgca cgcttgggat atggaaccag accgtgagca cggaaatgta       480
     tcaccggaga aactgtacgg aggagaaacc actgcagctg cagccagctc tttcgggaaa       540
     ggggttagat gctcacgagg atatggatac tctttcgtcc cggcaacttt ggaacaacag       600
     cattctgcag atgtcattgg tgggtcaagt ggtcttgggg atggacacat tctacctgac       660
     tgggggagcc tggggcggga gcgaatgttc tctccaatgg tgttgaggaa ggccactcgc       720
     ccggtgagaa cagcatgcaa gggggcaaca ctacatcccg cgcatgagag tcgggaagag       780
     gtgatgttcg aatgcagact cctgaatatc gtcacaattg attga                       825
//

If you have problems or comments...

PBIL Back to PBIL home page