(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE419

PENCW_13.PE419       Location/Qualifiers
FT   CDS_pept        join(complement(949994..950152),complement(949722..949814),
FT                   complement(949038..949391))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947731"
FT                   /orf_name="Pc16g04190"
FT                   /product="Putative uncharacterized protein Pc16g04190 "
FT                   /protein_id="CAP93089.1"
FT                   /db_xref="UniParc:UPI00018314F4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8F1"
FT                   /transl_table=1
FT                   /translation="MTPPFGRLCSLSSWHIMPHQPTHKMVSWSKVMARTVLRTEYIIGK
FT                   CERHGHGPVVQHPWIGTPYFVKIRGIGGSAMTTPGSIRNPGYFRRPEYFGQKSQVAELC
FT                   RSINVIDPRGHPRVSLVALRKGLWRCATISSALHITLEFRICQFRGASAPAGRIIHRTR
FT                   HKGTVYNMIGRAIQPGASPWAWSRSELGKRMRTQPAVM"
     atgactcctc cttttgggcg attgtgctca ctttcatctt ggcacatcat gccccaccaa        60
     cccactcaca agatggtctc atggtccaaa gtgatggcga gaacagtcct ccgtacggag       120
     tacatcatag gcaaatgcga gaggcatgga cacggaccag ttgtacaaca tccatggata       180
     ggtactccgt acttcgtaaa aattcggggg atcgggggat ctgctatgac gacccctggg       240
     tcgatccgta acccaggata ttttaggcgt ccggagtatt tcggccagaa aagccaagtg       300
     gctgagctgt gcagatctat caatgtgata gatccccgcg gccatcctcg tgtatccctt       360
     gtggcgctga gaaagggtct gtggcggtgc gcaaccatat cgagcgccct gcatataacc       420
     ttggaattcc gtatttgtca atttcgtggg gccagtgctc cagctggcag aataatccac       480
     agaactcgcc acaaaggaac ggtctacaac atgattggac gtgccatcca acccggtgca       540
     tccccatggg cgtggtccag atcggaattg gggaagcgca tgagaacaca acctgctgtt       600
     atgtga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page