(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE42

PENCW_13.PE42        Location/Qualifiers
FT   CDS_pept        join(93753..93767,94044..94208,94371..94586)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945519"
FT                   /orf_name="Pc16g00420"
FT                   /product="Putative uncharacterized protein Pc16g00420 "
FT                   /protein_id="CAP92712.1"
FT                   /db_xref="UniParc:UPI0001831E9A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V3"
FT                   /transl_table=1
FT                   /translation="MASGQDKMQNHDYRTPTSRRLGVRYKISIAMRTLEELNVGAGYNS
FT                   FQKRIPKKASCKMAELRLGDTRFTYLFPSTSGGSVKVPPPEEAWPLIVRLVNVGFLDTG
FT                   RWPIGPFPPLKTYWHIPSSLTFLVYFS"
     atggcgtctg gacaggataa aatgcaaaac catgattatc ggactcccac atctaggcgt        60
     ctcggggtga gatacaagat aagcattgcc atgagaacct tggaagagct gaatgtggga       120
     gctggttata actccttcca aaagcgaata ccgaagaaag ccagctgcaa aatggccgag       180
     ctcagactcg gagatactcg gttcacatat ctatttccgt cgacatctgg cggatcagta       240
     aaagtcccac ctccagaaga agcttggcca cttatagttc ggttggttaa tgttggcttc       300
     ctggacacgg gcagatggcc gattggtcct ttcccaccat tgaagactta ttggcatatc       360
     ccttcatctc tcacattcct tgtctacttc tcatga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page