(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE420

PENCW_13.PE420       Location/Qualifiers
FT   CDS_pept        join(complement(952854..952887),complement(952667..952761),
FT                   complement(952249..952318),complement(951440..951577),
FT                   complement(950606..950805))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947732"
FT                   /orf_name="Pc16g04200"
FT                   /product="Putative uncharacterized protein Pc16g04200 "
FT                   /protein_id="CAP93090.1"
FT                   /db_xref="UniParc:UPI00018314F5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8F2"
FT                   /transl_table=1
FT                   /translation="MEFGGAGGKIGDETILRRSVPILGTGYMRLMYYEYRDCGYLYSNR
FT                   VGPEHNSDPVQTPLVNPFHHGLFPRTGVTGDRCSGSGDRAQPGMIIQLYDSRIVMMMGN
FT                   DDVYSIYKEPLAAKIQDIWATNLERGVERSPNACLLIGTRRDPNSDLVDTWIVEPGENK
FT                   ATMNRCSGTSALAAR"
     atggagtttg gaggcgctgg ggggaagatc ggggatgaaa caatcttgcg aaggtctgtg        60
     cctatactgg gtactgggta catgagactt atgtactatg agtaccggga ttgcgggtac       120
     ctctactcca atagagttgg cccagaacat aattccgatc ccgtccagac tcccctcgtg       180
     aacccattcc accatggact gttccctcgt accggggtga ctggagaccg gtgctccggg       240
     tcaggcgatc gggcgcagcc cggtatgata atacagttgt atgattcgag gatcgtcatg       300
     atgatgggga acgatgatgt ctactctatc tacaaagaac cattggcagc aaaaattcaa       360
     gatatctggg cgacgaatct tgaacgtgga gtcgagagat ccccgaatgc ctgccttctc       420
     ataggaacgc gtagagaccc aaactctgac ctcgtcgaca catggatagt ggaacccgga       480
     gagaataagg caacaatgaa ccggtgtagc ggaacctctg ctctagctgc acgctag          537
//

If you have problems or comments...

PBIL Back to PBIL home page