(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE421

PENCW_13.PE421       Location/Qualifiers
FT   CDS_pept        join(953291..953620,953678..955510)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000207695" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977578"
FT                   /orf_name="Pc16g04210"
FT                   /product="Pc16g04210 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="transcription regulator activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP93091.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="UniParc:UPI00018315E0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8F3"
FT                   /transl_table=1
FT                   /translation="MSYIHPSWNYQGHQGIPMDQHMAYDPSMVPPPMMHPIDGYMYPHP
FT                   PMEMIDYYHQPIMDYDEYTENLSRPRLTKEQVETLEAQFQAHPKPSSNVKRQLAAQTNL
FT                   SLPRVANWFQNRRAKAKQQKRQEEFEKMTKAKAEAEEAARRKSETLDQLSGSRKGSIAN
FT                   EESEKSATPKQTPTSTSSGHAKTDSTSSRSKHHKTKSESAREATFASLQRALNAACAAR
FT                   DRFGRRINPRSKNESVPEEDEEEEAVSPGSMPPPKAVTPANDHGNLANINSSFSGWSGI
FT                   KEEPASWGSAEHNDNVGYSTTEQTSYSTSCHQAMADISNPSHSMQQNLDVYSNHLPPHT
FT                   EEWSEDRESRHDNLVYSNMQYPMPMQAPDISVTRRESSSALTSSLEGIGICTTGQSGLS
FT                   QPVDRVEATWKEPGKELDLAARRKRPRPAAIGTSGTRPLANSTSMSSLSPTARMPSSGA
FT                   GNSMRQSKSTQSLNSRYAGVRKASAAQRSPLNFTFADSGSIKKAEKMLRPSISTTSLAP
FT                   PTPLTPQDLQHFMPASPTDSNYCLSAHSTAHFFPTSQPMQVNMASPPATPLDIYSPFPY
FT                   QNVAPPMSAPAQVSSFPEYLTCDSVPIPARSWADTGSISSPEYPAGLQVPHSSTVSPMG
FT                   YNATTDHTGQAFGMESVSGSPSLIYSIEDTDIPGSAELAERKRPEFMMHEFPEHDTHFG
FT                   GHHLSSMQKPKAYTFANNTTPSNYPS"
     atgagttata tccacccctc atggaactac caaggtcacc agggaatccc aatggaccaa        60
     cacatggcat atgacccgtc catggtccct cctccgatga tgcaccctat tgacggctat       120
     atgtaccctc acccgccaat ggagatgatc gactactacc accaaccgat tatggactac       180
     gacgaataca cagagaattt gtctagacca cggttgacca aggaacaagt tgaaaccctg       240
     gaggctcagt tccaggctca tccgaaacca agcagcaacg tcaagcgtca attggcggct       300
     cagacaaatt tgagcctgcc tcgcgttgca aattggtttc agaatcgtcg cgccaaggcc       360
     aagcaacaga aacgccagga ggaatttgaa aagatgacga aggccaaggc cgaggctgag       420
     gaggctgctc gccgaaaatc agagaccttg gaccaactgt ctggatctcg aaaaggatca       480
     atcgcaaatg aggaatcgga gaaatctgcc actcctaagc aaacacctac ctctacatcc       540
     agtggccatg ccaagacaga ttccacatcc agccgttcca agcaccacaa aacaaagagc       600
     gagtcggcaa gagaagcaac ttttgcatct ctgcagaggg cgctgaatgc tgcttgtgct       660
     gcgcgggatc gattcggtcg ccggatcaac ccgcggagca agaacgagtc tgttcccgaa       720
     gaagacgaag aagaagaggc agtgtcccct ggctcaatgc caccaccaaa agcggtcact       780
     ccagctaacg accatgggaa tcttgccaac ataaattctt ccttttcggg ttggtctggt       840
     atcaaggaag aaccagcttc ctggggatcc gccgagcaca atgacaatgt gggatacagc       900
     actacagagc agacttcata ttccacttct tgccaccaag caatggcaga catttcaaat       960
     ccttcgcact ccatgcaaca gaacttggac gtctattcga accacctgcc ccctcacacg      1020
     gaagagtggt ctgaggacag ggaatcacgg cacgacaacc ttgtctacag caacatgcag      1080
     tatccgatgc ccatgcaggc accagatatc tcggtcacac gtcgtgagtc ttccagtgcg      1140
     ctgacttcct cactggaggg catcgggatc tgtactaccg gtcaatctgg gctgtctcaa      1200
     cctgtcgatc gagtagaagc aacttggaag gaacccggca aagagcttga tctcgccgca      1260
     cgccgcaaac gccctcgccc cgctgccatt ggcacctcag gaactcgtcc tttggccaac      1320
     tcgacctcga tgtcttcgct ctcgcctacc gctcgtatgc ctagctccgg cgctggcaac      1380
     tccatgagac aatctaagtc aacccagagc ctcaactccc ggtatgccgg cgtgaggaaa      1440
     gcgtcggctg cgcagcggtc tccacttaat tttacttttg cggattccgg gtctatcaag      1500
     aaggccgaga agatgctgcg accctcgatc tcgaccacta gcctagctcc accaacgccc      1560
     ttgactccgc aggacctcca gcatttcatg cctgcctccc ccacggatag caactactgc      1620
     ttgtcggccc actccacagc ccacttcttc cctacctctc aacccatgca ggttaacatg      1680
     gcatcacctc ccgctacgcc actggatatt tactccccct tcccttacca aaacgtggcc      1740
     ccgccaatgt cggctccggc tcaggtctct tccttccccg aatatctcac atgtgactcg      1800
     gttcccatcc cagcccgcag ctgggccgac actggttcta tatcttcgcc tgagtacccg      1860
     gcgggacttc aggtgccgca ttcaagcaca gtctcgccca tgggctataa cgcgaccact      1920
     gaccataccg gacaagcttt tggcatggaa tcggtctctg gctcgccgtc tttgatctat      1980
     tcgatcgaag ataccgatat accaggctct gccgaactcg cagagaggaa gcgacctgaa      2040
     tttatgatgc acgaattccc ggagcacgat acccactttg gtggtcatca cttgtcatcg      2100
     atgcagaagc cgaaagccta cacgttcgcg aacaacacga cgccaagtaa ctacccttcc      2160
     taa                                                                    2163
//

If you have problems or comments...

PBIL Back to PBIL home page