(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE422

PENCW_13.PE422       Location/Qualifiers
FT   CDS_pept        join(956487..956618,956725..956943,957002..957721)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000185073" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977579"
FT                   /orf_name="Pc16g04220"
FT                   /product="Pc16g04220 protein"
FT                   /protein_id="CAP93092.1"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI00018315E1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8F4"
FT                   /transl_table=1
FT                   /translation="MRLSTLGSALVGLAVAQASTINYTTVTGYFLQDEESTDPTTFDYT
FT                   AENFGLIGRAYPADKEHKKHGSLTQWERFYHQVTKLNEHSPKHVEYKVLFLGRHGEGWH
FT                   NAAESYYGTPAWNCYWSELNGNSTASWADSDLTPGGISQALKANEFWQKEINEQRIHTP
FT                   DHYYVSPMTRALKTANLTFTGLDMPKHSAAFKPTVKELFREGISVHTCDHRRSRSYIHD
FT                   LFPHWPIEHGFTEEDELWNGVTAEPSGAQDVRSAQALGDVFFTSSKKKSFVSITSHSGE
FT                   ISSILRVIGHRTFKLSTGAVIPVLVKAEKVDEEPATSSVSWEVSPHCTEPPVTSVTACV
FT                   CPSSAVPVTTPLATGF"
     atgagactct ccaccctcgg ttcagccctt gtgggcctag ctgttgcgca ggcatcgacc        60
     atcaattaca ccacggttac aggctatttt ctacaggatg aggagtcgac tgatcccact       120
     acatttgact atacagcgga gaatttcggc ctgatcggcc gcgcttatcc tgcagacaag       180
     gagcacaaga aacacgggtc tctgacccaa tgggagcgct tctaccacca ggttactaag       240
     ttgaatgagc attcgcccaa gcacgttgaa tataaggttt tgttccttgg tcgacatggg       300
     gaagggtggc acaatgctgc cgaaagctac tatggaacac cagcgtggaa ttgctactgg       360
     tccgaactca acggcaacag cacagcaagc tgggcagatt ccgacctcac acctggcggt       420
     atctcacagg cgctcaaggc aaatgagttc tggcaaaagg agataaacga acagcgaatc       480
     cacacaccag accactacta tgtcagccca atgacacgcg ctctgaagac cgccaaccta       540
     actttcacgg gcctggacat gcccaaacac agcgcggcct tcaagccgac cgtgaaggaa       600
     ctcttccgtg aaggaattag cgtccacacc tgcgaccacc gtcgtagccg cagctacatc       660
     cacgacctgt tcccgcactg gcccattgag catgggttta ccgaggagga tgagctgtgg       720
     aatggcgtta cggctgaacc tagtggcgcg caggatgtcc ggagtgccca ggctttgggg       780
     gatgtcttct ttacttcgtc caagaagaag tcgtttgttt cgattacgtc gcattcgggt       840
     gagatctcct ctattctgag ggttattgga caccggacct tcaagctgag tactggtgct       900
     gttattccgg tgttggtcaa ggctgagaag gttgacgagg aaccggctac ctcttctgtg       960
     tcttgggaag tgagtccgca ctgtactgag ccgcccgtta cttcggttac ggcttgtgtt      1020
     tgtccttcca gtgcggtgcc tgttacgacg cctttggcta cgggtttcta g               1071
//

If you have problems or comments...

PBIL Back to PBIL home page