(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE423

PENCW_13.PE423       Location/Qualifiers
FT   CDS_pept        join(959757..960176,960241..961452)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947733"
FT                   /orf_name="Pc16g04230"
FT                   /product="Putative uncharacterized protein Pc16g04230 "
FT                   /protein_id="CAP93093.1"
FT                   /db_xref="UniParc:UPI00018315E2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8L0"
FT                   /transl_table=1
FT                   /translation="MDPSETQSPPSSRLSAMVLSSSPSDPLAVMASNCSPSEQLSAMIL
FT                   NSSPTQQAPPDASRDAPRDAPTKAPSSRASLFGNGRPSRTPSPPGTPSPLDRRISNKLN
FT                   RSPSRAHRVDALSDQTSGDFPYLAREPSLPYEAWENVFYAMLATYSYEEYDFTYGDVFE
FT                   QPETKKTLSTLRLVNRIWNRIATPLLFRNIQAVVGYSAGRPLDSILRISESPYALYVRD
FT                   VRFGFVGSWLPGLDYDRYIDDLAAGALPILISRFQNIQTLRLQTPTVIDTFSEEGQLKP
FT                   AMLAKLTNALVHTLRLVSVPILKCLHISMPTTAEFARFFESNSYTGGFTNIFGQLEELH
FT                   ITINDSTGPDGRRDPKWPRSVIKTKYPPDRFAPYLIQLIAYARRIQVFSLDARTWFDVS
FT                   DLEAESFTKLKSFRLEGVRINHKTLRQIFIEARDTLHRIQLVHVRLMSGTWQEVFDHSA
FT                   LPPKDLSWLYVHGCGYSMTGASARYMGSTFSRYPTALWTRYAPDWLAITHWRTVVNTNR
FT                   QRRSLPICPYCYYPSIEPILRDLGSN"
     atggatccat cggaaaccca aagcccaccc tcgtcgcggc tatctgcgat ggtcttgagc        60
     agctcgccgt cagacccgct ggctgtgatg gcctcaaact gctctccctc ggagcagctg       120
     tctgcaatga ttttgaacag ctcgcccact cagcaggcgc cacctgatgc ttcgcgtgat       180
     gctcctcgtg atgctcctac taaggctccc tcctctcgcg cctccttgtt tggtaacggc       240
     cgcccttctc gcaccccatc ccctcccggt acaccttccc cgctggacag gcgcatatcc       300
     aacaagttga atcgttctcc ttcgcgggct catcgtgttg acgccctgtc tgatcaaacc       360
     tctggagatt ttccttactt ggctagagag ccatcgctcc cgtatgaagc ttgggaaaat       420
     gtcttttacg ctatgcttgc tacttactcg tatgaagaat atgacttcac ttatggggat       480
     gtctttgaac agccggagac taaaaagact ctttcgactc tgagactcgt gaaccgaatc       540
     tggaaccgga ttgcgactcc tctcctcttc cgaaacatcc aggccgtcgt cgggtactcc       600
     gctggtcgac ctcttgatag catcctaagg atttctgaaa gcccatatgc cctttacgtg       660
     cgcgacgtgc gttttggttt tgtgggatca tggcttccag gactggacta cgatcgatat       720
     atcgacgact tagcagcagg agctcttcca atcctgatca gtcgtttcca gaacattcaa       780
     acgttgcggt tgcaaacccc caccgtgatt gacacattta gtgaagaggg acaactcaag       840
     ccggcgatgc tagcaaagct gacaaacgct cttgtgcata ccttacgctt ggtgtctgtc       900
     ccgatactga aatgcctcca tatttccatg cccaccaccg cagaatttgc ccgtttcttc       960
     gagtcgaaca gttacaccgg gggcttcacc aatattttcg gccaactcga agagttacac      1020
     atcactatta atgacagcac cggccctgac ggcaggcgag acccgaaatg gccccgctca      1080
     gtgatcaaga ccaagtaccc gcccgaccga tttgctccgt atctcatcca gctcatcgct      1140
     tacgcgagac ggatccaggt cttcagtcta gatgcccgta cctggtttga cgtgtccgat      1200
     ctggaagcag aaagtttcac taagctaaaa agcttccgac tcgaaggtgt gagaatcaac      1260
     cacaaaaccc tcaggcagat tttcatagag gctcgggata cactgcatcg tattcagttg      1320
     gtccacgttc ggctcatgtc tggtacctgg caggaggttt tcgatcattc tgcacttcct      1380
     ccgaaggatc tttcgtggct ttacgttcat ggatgtggct attcgatgac aggtgccagt      1440
     gccagatata tgggttctac gttctcgcgc tacccaacag cactctggac ccgctatgcc      1500
     cccgactggt tggctattac gcactggaga acggtggtga atacaaaccg ccaacgcagg      1560
     agtctgccga tatgtccgta ttgctattat ccgtcaattg agccgattct ccgtgaccta      1620
     gggtctaatt ag                                                          1632
//

If you have problems or comments...

PBIL Back to PBIL home page