(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE424

PENCW_13.PE424       Location/Qualifiers
FT   CDS_pept        join(complement(966869..966932),complement(966568..966681),
FT                   complement(964539..966427))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207684" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977580"
FT                   /orf_name="Pc16g04240"
FT                   /product="Pc16g04240 protein"
FT                   /protein_id="CAP93094.1"
FT                   /db_xref="InterPro:IPR013933"
FT                   /db_xref="UniParc:UPI00018315E3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8L1"
FT                   /transl_table=1
FT                   /translation="MNGMDIIDGSGTIDPANLSNSVSVALPAHSHAIASPRGVKRSRTP
FT                   DRMGNGRGQGGQDDEEQSRRKRGRPPKTPRPSSSDQAIANTSVQTPQMQARPLSQATAG
FT                   SPSLASPDSKGTPTKALVKALPTVRDHTSDQLNEEGDEYIPKEFDEAGETKADPMGYPL
FT                   GGREYKCRTFRVPLRGRKLFMLATECARVLNYRDSYLLFNKNRSLHKIIASQIEKDDLI
FT                   QQDILPYSYRSRQIAIVSARSMFRQFGSRVIVNGRRVRDDYWESKARKQGFTEDDLAGE
FT                   KRPGAAKARDGSVSEPATNMLPALPHNDVVYSNAIEPLPHGLSLDTSESSLSLAPVPMI
FT                   QMSTTDDPRLRDYTVMPRARQELTGQAYHDRTQTSSAADLMNQAQHTSDFNKMLSIQRS
FT                   FRQKGLDEFYSKPREAPVSETQSNTALESGLSVSQPVQVSQMPSAGMPNPAHTQHMLPQ
FT                   QVPMQPNPMMAGQPNYPQQPHPQSVGQAPLRIPPNMQPNLMQQRSNPSMGGGMGQAPPY
FT                   GYTPQQQQIWGQPPPQPQPSPLPSSGHHGVGMAQYGQQMSAGPQQSPSPLGHHPQQQHP
FT                   QQSPRNQQRQSIPQMPQQYSQMQHPQAPQTQGMQGMGYPGANPAGYPSVARAMYPPNQS
FT                   QPFMGGNPQQAGIAMNMAGNGMPGWPAGPGGPMQPGQPQPGQSGSPLGGGWSY"
     atgaacggta tggatattat tgatggctcg gggaccatcg atcctgcaaa cttgagcaac        60
     tccgtctctg ttgccctacc agcacattcc catgcaatag caagcccccg tggtgtcaag       120
     cgtagtcgca ctccagaccg catgggaaat ggacgtggcc aagggggtca ggatgatgag       180
     gaacaaagtc gccgcaagcg tggccgtccc cccaagactc ctaggccaag ttctagcgac       240
     caggccatcg caaacacttc tgttcaaacc cctcaaatgc aagcacgccc actatcgcaa       300
     gccaccgccg ggtcaccgtc tcttgcatca ccggacagca aaggcacacc aacgaaagca       360
     ctggtcaagg cgctccctac tgtgcgagat cacacatcag accagctgaa tgaagaaggc       420
     gatgagtaca tccctaaaga gtttgatgag gcaggagaga ccaaggcgga tcctatggga       480
     tatccgctgg gtggccgcga atacaaatgc cggacattcc gcgttcccct ccggggcaga       540
     aagctattta tgcttgcaac tgagtgtgcg agggtgttga attatcgtga ttcatatctt       600
     ttgttcaaca agaaccgatc gttgcataaa atcattgctt cccagattga gaaagacgat       660
     cttatccagc aagatatcct gccgtattcc tatcgctctc gccaaatcgc tatcgtctcc       720
     gccagatcca tgttccgcca gttcgggagc cgggtaatcg tgaatggccg ccgcgttcga       780
     gacgactact gggaatccaa ggctagaaag cagggcttca ccgaggatga cctcgcgggt       840
     gagaagcgcc ctggggcagc caaggctcgg gatggttccg tctcagagcc agccacaaac       900
     atgttgccgg cgctgcctca taacgatgtt gtctacagta atgccatcga gccattgcct       960
     cacgggctct cgctggatac ttccgaatct tctttgtccc tagctccagt ccccatgatt      1020
     caaatgtcga cgacggatga cccgcggctg cgggattaca ctgtcatgcc tcgtgcacgc      1080
     caggaattga ccgggcaagc ttaccacgac cgcacgcaaa ctagttcagc agcagacctc      1140
     atgaatcaag cccaacacac gtctgatttc aacaaaatgc tgagcattca gcgcagtttc      1200
     cgccaaaagg gcttggatga attttactcc aagccccgcg aggccccagt ttcagagacc      1260
     cagtctaata ctgctcttga gtctggtctg tctgtgtcac agcctgttca agtgtctcag      1320
     atgccctcgg ccgggatgcc aaatcccgct catacgcagc atatgctccc tcagcaggtc      1380
     cccatgcagc ctaatccaat gatggctggg caaccaaact acccccaaca gccccacccc      1440
     cagtccgtag gacaggctcc cctgaggata ccacccaata tgcagcccaa tcttatgcaa      1500
     cagcggtcca acccatccat gggtggcggt atgggtcaag ctcctccata cggatataca      1560
     ccgcaacaac aacagatttg gggacagcca cccccacagc cacagccatc cccgttgccg      1620
     tcatcgggac accacggcgt tggaatggct cagtatggtc aacaaatgtc tgcaggtccg      1680
     cagcaaagcc catctcccct cggacatcat ccgcagcagc aacaccccca gcagtctcct      1740
     cgcaatcaac agcgacagtc aatacctcag atgcctcagc aatattccca gatgcaacac      1800
     cctcaagcgc cgcagactca gggtatgcag ggcatgggat atccgggagc caacccggcc      1860
     ggttatccga gcgtggcacg agccatgtat ccacccaacc agagccaacc cttcatgggt      1920
     ggaaaccctc aacaggcggg tattgcaatg aacatggcag gcaatggtat gcctgggtgg      1980
     cctgccggac cgggtggccc gatgcaaccc gggcaacctc aaccgggcca gtctggcagc      2040
     cccttaggag gtgggtggtc gtactag                                          2067
//

If you have problems or comments...

PBIL Back to PBIL home page