(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE429

PENCW_13.PE429       Location/Qualifiers
FT   CDS_pept        join(974216..974266,974409..974627,974691..974759)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977836"
FT                   /orf_name="Pc16g04290"
FT                   /product="Putative uncharacterized protein Pc16g04290 "
FT                   /protein_id="CAP93099.1"
FT                   /db_xref="UniParc:UPI00018315E6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8L4"
FT                   /transl_table=1
FT                   /translation="MAPANAAQLLANTCKQFEISIHPKHKILNYASLTVGAISTSVAPS
FT                   SKQYHTITNSIKQTRGSLRVPGAEPLNYSVDRAAPLARNYLTKDEIVSSSSRLPFQDYI
FT                   SRITIRFV"
     atggctcctg caaatgcagc ccagctattg gccaatacct gcaagcagtt cgagatatct        60
     atacatccga aacacaagat tctgaactac gcgagtctta ccgtaggggc aatatccact       120
     tccgttgccc cctcatcgaa gcagtatcat accatcacaa attcgatcaa acagacccgc       180
     ggaagccttc gtgttccagg ggctgaacct cttaattatt ccgtcgatcg cgctgcccct       240
     ttagcccgca actatttgac caaggacgaa attgtctcct cttcgagccg ccttcccttt       300
     caagactaca tctctcgcat cacgatccgc tttgtgtga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page