(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE43

PENCW_13.PE43        Location/Qualifiers
FT   CDS_pept        join(95191..95608,95822..96138)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179103" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945520"
FT                   /orf_name="Pc16g00430"
FT                   /product="Pc16g00430 protein"
FT                   /function="homocysteine S-methyltransferase activity "
FT                   /protein_id="CAP92713.1"
FT                   /db_xref="GO:0008898"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="UniParc:UPI0001831E9B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V4"
FT                   /transl_table=1
FT                   /translation="MASQSKLPQLTSSNLFVTEGGIETTLIYRNNLDLPSFSTLPLLNT
FT                   EDGRQTISSIYQEYVNIALAHSTGVVLETRTWRGSPLWSPEIGLSIPQILDLNRTAVKI
FT                   LHDIRNKTPSTSVVISGALGPLQDAYQDSTGTVSFVDRLTENYTTYFGVNCAHPRYIIK
FT                   AVRGMHTDVRSRIGSIRGNSSLKSHDELDNSLVLDRGDISVWVREFNELLNMLPGLKVV
FT                   GGCCGTDEEHIDAIASRINSVG"
     atggcctcgc aatcgaagct cccccagttg acttcctcca accttttcgt caccgaaggc        60
     ggaatcgaaa caactctcat ctacagaaac aatctcgatc tccctagctt ctccactctc       120
     ccacttctca atacggaaga tggtagacag actatctcgt ccatctacca agaatatgtg       180
     aatattgccc tcgcccactc aaccggcgtc gtcctcgaaa ctcgaacgtg gcgcggctcc       240
     cctttatggt ctcccgaaat tggactctcc atcccacaga tcctggacct gaaccgcaca       300
     gcagtcaaga tcctccatga cattcggaac aagactccat ctacttctgt ggtcattagt       360
     ggggcccttg gacctcttca agatgcctac caggattcca cgggcacggt ctccttcgtc       420
     gaccgtctaa cggagaatta tacaacgtac tttggggtga attgtgccca tccgcgttat       480
     attataaaag cggtacgagg tatgcataca gatgtgaggt cgaggatcgg gtcgattaga       540
     gggaattcaa gtcttaagag tcacgacgag cttgataact ctctggttct agatcggggc       600
     gatatttcgg tttgggttcg agagttcaat gagcttttga atatgttgcc gggactgaaa       660
     gtggtagggg gttgctgtgg cacggatgaa gagcatattg atgctattgc gagcaggatt       720
     aattctgttg ggtaa                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page