(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE430

PENCW_13.PE430       Location/Qualifiers
FT   CDS_pept        join(complement(975088..975612),complement(974876..975004))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948767"
FT                   /orf_name="Pc16g04300"
FT                   /product="Putative uncharacterized protein Pc16g04300 "
FT                   /protein_id="CAP93100.1"
FT                   /db_xref="UniParc:UPI00018315E7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8L5"
FT                   /transl_table=1
FT                   /translation="MAVARLRNLHVRPQFSPSHSLPLSLSLCLCLCLCLCLCLSVIQNL
FT                   RGTFTSDISNSSYTWDEMSQATPVRIVLPYREQPFQKPTAIINAFFTWRGIQPLREDYY
FT                   THICSDPRSSRLYLVLDLHCKTHPNVDLSNLDLEVFKVSGIDPLCVILFYNLTKLTVFS
FT                   TFQDLGEVARKQGGQYPAISMSCTSRSNGRSLRNPEGGMHGSFTVLLAGVQKIM"
     atggctgttg cgcggttacg taatctacat gtgaggcctc aattctctcc ctcccactcc        60
     ctccctctct ctctgtctct ctgtctctgt ctctgtctct gtctctgtct atgcctgtct       120
     gtgattcaga atcttcgagg aacctttaca agcgacatca gcaactcttc ttacacttgg       180
     gacgaaatga gtcaggctac tccggtgcgg atagtccttc catatcgcga acaacctttt       240
     caaaagccta cagcaatcat taacgctttc tttacatggc gaggtattca acccctccga       300
     gaagactact atacacatat atgcagtgat cctcgatctt ctcggttata tctcgttctc       360
     gatctccact gcaaaacaca tccaaatgtc gatcttagca atttagacct cgaagtcttc       420
     aaagtctcag gaattgatcc attgtgcgtt atcctcttct ataacctaac taagctaaca       480
     gtatttagta catttcagga tctcggagag gtagctcgca agcagggagg acagtatccc       540
     gctatatcca tgtcttgcac atcgagatcc aacgggaggt ctctcagaaa ccctgaggga       600
     ggcatgcatg ggtcatttac agtgcttctt gcgggtgtac aaaagataat gtga             654
//

If you have problems or comments...

PBIL Back to PBIL home page