(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE432

PENCW_13.PE432       Location/Qualifiers
FT   CDS_pept        join(complement(980179..980301),complement(979691..980113))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234872" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948768"
FT                   /orf_name="Pc16g04320"
FT                   /product="Pc16g04320 protein"
FT                   /function="carbon-sulfur lyase activity"
FT                   /protein_id="CAP93102.1"
FT                   /db_xref="GO:0016846"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniParc:UPI00018315E8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8L6"
FT                   /transl_table=1
FT                   /translation="MAAAADKIKPYIPLAGCADDGWTKEDQATATCYCGGVQLAFPTQS
FT                   PGLVDTFICHCTDCRKITASMFATNFIIADTYLKHIRGEEILTAFKQSKTIASGKAMTN
FT                   CFCSTCGSLMYRISEAFPGHSILRTGTVDDFNLHETKLKPRTEMYAKDRVEWLCGASGV
FT                   KQVEGSMSTPKTTGPPRL"
     atggcagctg cagctgataa aataaaaccc tacatacctc ttgccgggtg cgccgatgat        60
     ggctggacaa aagaagacca ggcaacagcc acatgttact gtggcggggt gcagttggca       120
     tttccgacac aaagcccagg cctagtcgac acgttcattt gtcattgtac agactgccgc       180
     aaaatcaccg cgtctatgtt cgccaccaat ttcattatcg cagacacgta cctcaaacac       240
     atacgaggcg aagaaatcct tacagcgttc aaacagtcga aaactattgc ctccggcaag       300
     gctatgacga actgcttctg ttctacgtgt ggctcgctca tgtaccgcat cagtgaagct       360
     ttcccgggac acagtatcct gcgtaccggt acagtggacg atttcaatct gcatgaaaca       420
     aaattgaagc ctcgaactga gatgtatgcc aaggaccgtg tggaatggct gtgtggtgcg       480
     agtggcgtca agcaggtgga gggatcgatg tctactccga agacaactgg tcctccaaga       540
     ctttag                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page