(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE433

PENCW_13.PE433       Location/Qualifiers
FT   CDS_pept        982455..983162
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948769"
FT                   /orf_name="Pc16g04330"
FT                   /product="Pc16g04330 protein"
FT                   /protein_id="CAP93103.1"
FT                   /db_xref="UniParc:UPI00018315E9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8L7"
FT                   /transl_table=1
FT                   /translation="MSPATRLLDEYLKEGGYQKWGWVIYRSTYQNDEDWNCFKGVITEA
FT                   MRKSIEHHKTPDLDHSLNQSLSLTFLEDRPNFENASKDQLRAHFQEWAQRAYYAENPRP
FT                   FEEFNPDLATAPRYRYFIQIDEKSLQSLLHDTESGPRLRGLQSNGYVNFVDGWWKSLRE
FT                   QYATSQDPDLKEEIDEQLAHGYQSIEGCVEENTGWTMLHRLDMSVSFYHYTSGFVEDVW
FT                   PLYYQRPPGIALW"
     atgagtcccg caacacgtct acttgacgaa tacctcaagg aaggggggta ccaaaaatgg        60
     ggctgggtga tctatcgctc cacgtatcaa aacgacgaag actggaactg cttcaagggg       120
     gtgattacgg aggcaatgcg caaatccatc gagcaccaca aaactccaga tctcgatcac       180
     tctctgaatc aaagtctgag tttgacattc cttgaggacc ggcccaactt cgagaatgca       240
     tcaaaggatc agcttcgcgc gcactttcag gagtgggctc agcgtgcgta ctatgctgaa       300
     aacccgcgac cgtttgaaga attcaacccc gacctagcga ccgcacccag ataccggtac       360
     tttatccaga ttgacgaaaa gtctctgcaa agccttcttc atgacaccga aagtggtcct       420
     cggttgaggg gtctacaaag taatggctat gtgaattttg tggatggttg gtggaaatca       480
     ttgagggagc agtatgcaac gagccaagat ccagacctta aagaagagat tgatgagcaa       540
     ctagcgcacg gttatcagtc aatcgagggt tgcgtggagg aaaataccgg ctggacgatg       600
     ctacacagac ttgatatgag tgtcagtttc taccactaca caagtgggtt tgtagaggac       660
     gtgtggcctc tctattacca gcgtccgcct ggcattgctc tctggtaa                    708
//

If you have problems or comments...

PBIL Back to PBIL home page