(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE434

PENCW_13.PE434       Location/Qualifiers
FT   CDS_pept        985719..986294
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207673" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948770"
FT                   /orf_name="Pc16g04340"
FT                   /product="Pc16g04340 protein"
FT                   /protein_id="CAP93104.1"
FT                   /db_xref="UniParc:UPI00018315EA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8L8"
FT                   /transl_table=1
FT                   /translation="MNTGTTQRAPKTPKPTASVPIVQNKRWPPMANRNALPYKLTHLSK
FT                   EKLAREATAPDPDLRRCVAHFRLHCGSVSWTENDMKSRISSFDFEDTDEEDDVDEINTE
FT                   LPVLKNRAPTNETPVEVTQQLSQKSEPVAVAATPTPPAPPASPESTSSTSSENSSEHGF
FT                   LEKGRNCLEATSKHLWTGGSCIVSPIAG"
     atgaacaccg gcactactca aagagccccc aagaccccaa aaccaaccgc ctccgtgcca        60
     attgtgcaaa ataaacgctg gcccccaatg gcaaaccgaa atgccctccc ttacaagctc       120
     acccatctgt caaaagagaa actcgcccgt gaagccactg caccagaccc ggaccttcgc       180
     cgctgcgtgg ctcacttccg tctgcactgt ggatctgtct cttggaccga gaacgacatg       240
     aagtctcgca tcagctcatt cgacttcgaa gataccgatg aggaagacga tgtggatgag       300
     atcaacacag agctgcctgt cctaaagaac agagccccga ccaacgagac tccagtcgag       360
     gtcacccaac aattatcaca aaaatcagag cctgtcgctg ttgcggcaac tccgacacca       420
     ccagcaccac ctgcatcacc tgaatcaaca tcatcaacct cgtctgaaaa ttcctccgag       480
     catggttttt tggaaaaagg tcgcaattgt ctcgaggcga cctctaaaca cctctggaca       540
     gggggatctt gcatcgtatc cccaatcgcg ggttga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page