(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE435

PENCW_13.PE435       Location/Qualifiers
FT   CDS_pept        join(complement(989283..991210),complement(989108..989221),
FT                   complement(988395..989037))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217652" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948771"
FT                   /orf_name="Pc16g04350"
FT                   /product="Pc16g04350 protein"
FT                   /protein_id="CAP93105.1"
FT                   /db_xref="UniParc:UPI00018315EB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8L9"
FT                   /transl_table=1
FT                   /translation="MKLDSRFFFFSLALAVQAYDDALGLSNGYTSLSTANFDIKLVKDS
FT                   QVLASLKPAGEAFDFLPFDDITYRAANGQYHNGDIAYRYRLSGSTEWTAGDSSKTRKSL
FT                   KSAESDALAAAEMTRTLPTSPIHILREWIDVDGDLGLTFTLTNKGKQTLEIGSLGFPTE
FT                   FNSIFSNRTAEDMVAKCSLTDPYIGMDAGYLQVNPTSGTGASLIVTPLFNTSTPLEAWR
FT                   NLGEPSTEPLLYGSQTFEGFYEWQTHTKAYAENEWSGVTPWNEPSSRLVSPGESVTYGL
FT                   RFTVVKDGVRGIHDAVKATNTPATPGIPRYVVPVDLTARLYVFHSRISEVVSEDNSFKI
FT                   TQGANGILSLTPTGSVWGRTRVTITYEDGKVQTVHYFIMDSVPATIGKLGEFSTTSMWF
FT                   NDTEDPFHRAPSVITWDHSTQAQVLQDPRVWISGLSDEGGVSYLASAMKQSGLADATEV
FT                   SKLEQFASDVLSKTIQNPDFTVRKSIFFYETAQLPEYTYDRSIDWGNWWSWNKDASYAT
FT                   DRAYNYIHVIGAYWALYRAGRDNGSLLKTHTWQWYLSQAYNTTVTCFATDSAGNGLVGY
FT                   SRLGLMGETVVGELLSDLRREEWTAEADAVEAAMKLRAEAWDTEDVPFGSEMAWDSTGQ
FT                   EGIYYWSNYFKLTNTATKTINSILGYMPTVPHWGWNGNARRYWDFIYGGKLQRIERMIH
FT                   HYGSSLNALPLLSHFRQNPTDTYLLRVGYGGIIGPLSNIRQDGSMYNAFHSFPDTLQGD
FT                   DYSGDYGPNFLGMMLGSAVYVVDDPDVGLVAYGGNIDTNGDTVTVQPRDAVRRRVYVAQ
FT                   MGVYVTISAGLIEEVSFDISRPTSLQLRIVPGSSDVSSVVAWVETPGTEDEYAVAGDQL
FT                   ERVRGGWNVKFASEEANVVVSKL"
     atgaagcttg attcgagatt cttctttttc tctcttgccc tggctgtgca agcatacgac        60
     gatgcacttg gtttaagtaa tggctatact tctttatcta cagccaactt tgatatcaaa       120
     ttagttaaag attcccaagt ccttgcctcc ctcaaaccag ctggagaggc attcgacttc       180
     ttgcctttcg acgatatcac atacagagcg gcaaatggcc aatatcataa tggggacatt       240
     gcatatcgtt atcgactatc gggctcaaca gagtggactg caggcgactc atcaaaaaca       300
     aggaaatcgt tgaaaagtgc cgagtccgat gctcttgctg ccgctgagat gacacgaacc       360
     ctaccgacct ctcctatcca tatccttcga gaatggattg atgtggacgg cgatctcggc       420
     ttgaccttca ctctgaccaa caagggaaag cagacactgg aaattggcag tctaggcttt       480
     ccaaccgaat tcaacagtat cttctccaac cgcacagcgg aagatatggt ggctaagtgc       540
     tcgctcacag atccatacat cggaatggat gctgggtacc ttcaggtgaa ccccacgtct       600
     ggaaccgggg catcgttaat cgttacccca ttgttcaaca caagcactcc actagaagca       660
     tggcgaaact taggcgagcc gagtaccgaa cctctcttat acggcagtca gacatttgag       720
     gggttctacg aatggcagac tcacaccaaa gcctacgctg agaatgagtg gtctggtgtc       780
     accccgtgga acgagcctag ctctcgactt gtgagccccg gcgaatcagt gacctacggt       840
     ttgcgcttca ctgttgtcaa ggatggtgtg cgtggtatac acgatgcagt caaagccacc       900
     aacacgcctg ctacgccggg cataccgagg tacgtggtac cagtcgatct cacagctcgt       960
     ctttacgtct tccactctcg aatctctgag gtcgtatccg aggacaactc ctttaagata      1020
     acccaaggtg cgaatggcat tctgtcgctc accccgactg gctcggtctg gggtcgaact      1080
     agagtaacca tcacatacga agacggcaaa gtccaaacgg tacactattt cattatggac      1140
     tcggtaccag caacaatcgg caaattgggc gagttcagta ccacgtcgat gtggtttaat      1200
     gacacagaag atcccttcca ccgagctcca tcagtgatta catgggacca ctcaacccaa      1260
     gcgcaagtcc tccaagatcc ccgagtctgg atatccgggc taagcgacga aggcggcgtg      1320
     agctacttag ccagcgcaat gaaacagtct ggtctagccg acgcgacaga agtatcgaaa      1380
     ctcgaacaat ttgcttctga tgttctgtcg aagactatcc aaaacccaga cttcaccgtc      1440
     cgcaagagta tcttctttta cgagactgct caactccctg agtacacata cgatcgctct      1500
     attgattggg gtaattggtg gtcgtggaat aaggatgcct catatgctac ggaccgtgcc      1560
     tacaactata tccatgtgat cggggcatac tgggcgctgt accgggcagg tcgagataac      1620
     gggtcgcttc taaaaacaca cacgtggcag tggtatctca gtcaagcata caataccaca      1680
     gtgacctgtt tcgccacgga ttcagccggg aatggactcg tgggatattc gcgtctcgga      1740
     ctcatgggcg aaactgtcgt tggcgagctt ctgtcggatt tgaggcgtga ggaatggaca      1800
     gccgaggccg acgctgtgga ggctgctatg aagcttcgcg ctgaggcatg ggatacggag      1860
     gatgttcctt ttggcagtga gatggcctgg gactcgactg gccaagaggg aatctactac      1920
     tggagcaact atttcaagtt aaccaacaca gcaacgaaga ccatcaacag catcctgggg      1980
     tatatgccca cagtgccaca ttggggatgg aatgggaatg cccggcgata ttgggacttc      2040
     atctatggcg gcaagctaca gcgcatcgaa cgcatgatcc atcactacgg atcgagcctc      2100
     aatgcactac cattgctatc acacttccgc cagaatccga ccgacacata tctcctccga      2160
     gttggctacg gcggaataat aggaccacta tccaatatcc gacaagatgg ctcgatgtac      2220
     aatgctttcc actccttccc tgataccctg caaggcgacg attattcagg cgattacggt      2280
     ccaaacttcc taggtatgat gcttggatct gctgtgtatg tcgtcgatga tccggatgtc      2340
     gggctcgtcg catacggcgg gaatatcgac accaatggag acacggtcac tgtgcagcca      2400
     cgagatgctg tgcgtcgtcg ggtgtatgtt gcacaaatgg gggtatacgt caccatcagc      2460
     gctggattga tagaagaggt ctcgtttgat atttctcggc caacgtctct tcaactgcgt      2520
     atcgttcctg ggtcatcgga tgtctcttct gttgttgctt gggtcgagac tccgggtacg      2580
     gaggatgagt atgctgtggc tggagatcaa ttggaacgtg tgcgaggagg ctggaatgtc      2640
     aagttcgcct ctgaggaagc gaatgttgtt gtctctaaac tgtga                      2685
//

If you have problems or comments...

PBIL Back to PBIL home page