(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE436

PENCW_13.PE436       Location/Qualifiers
FT   CDS_pept        join(complement(993381..993511),complement(992887..993319),
FT                   complement(992636..992833),complement(992308..992583))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211110" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824609"
FT                   /orf_name="Pc16g04360"
FT                   /product="Pc16g04360 protein"
FT                   /protein_id="CAP93106.1"
FT                   /db_xref="UniParc:UPI00018315EC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Q5"
FT                   /transl_table=1
FT                   /translation="MNEHEHNKAPNHSRPLLYVPNTLWTRLFAATVVIETVLTVAIESW
FT                   ILMSLWDDLDSDSESNGTMRLQSFLGLYIFALLYELALSYDALRRKNTIQLVGLCICNQ
FT                   GLFTYGLLQMNEIKDTISSSTNKDFGDRLKDVYHIEIIIVPVILGVGTVCMSFFTWKLR
FT                   AEFSWSIYKNVSADLQMKRRYFTYQVYIALLKFDFFFVFGTQLQILLVIFQAPEDMDFV
FT                   VNASVIPITIATLVLSAQFCKREKRKSLMFMMFLMLLIVGFLVLILLRMYSPGDHTDFS
FT                   SFRTSLTLFAGVSLLLMVLTIINSVMCILNFNKGLKNHVHPPKKGKTVSLELESQETPT
FT                   RFLLN"
     atgaacgaac acgaacacaa caaggccccc aaccacagcc gacctctact atacgtcccc        60
     aacacattat ggacgcgatt gtttgcagca acggtggtca tcgagacggt cctcacagtc       120
     gcaattgaaa gctggattct catgagcctg tgggacgacc tcgacagcga cagcgaatca       180
     aacggaacaa tgcgccttca gtcatttcta ggcctctaca ttttcgctct tctatacgaa       240
     ttggcactgt catatgatgc gctccgccgg aagaacacaa tccagctggt cggtctctgc       300
     atctgtaatc agggcctgtt cacatatggc cttctccaga tgaatgagat caaggatact       360
     atctctagct cgaccaacaa ggactttggc gaccgtttga aggacgtgta tcatatcgag       420
     atcatcattg tcccggtgat tttgggtgtc gggactgtgt gcatgagctt tttcacgtgg       480
     aagttgcgcg cggagttttc gtggtctata tacaagaacg tcagcgcgga cttgcagatg       540
     aagcgtcgat attttacgta tcaggtgtat atcgctctcc taaaattcga tttcttcttc       600
     gtatttggaa ctcagctcca aatcctcctt gttatatttc aagcccccga agacatggat       660
     tttgtcgtca atgcctctgt gatcccaatc acgatagcga ccttggtcct atcagctcaa       720
     ttttgcaagc gcgagaaaag gaaatctctc atgttcatga tgttcctgat gcttcttata       780
     gttggattcc ttgttctcat cctccttcgg atgtacagcc ccggcgatca cactgatttc       840
     agctctttcc ggacgtccct gacgttattc gcaggtgtct cgttgctgct gatggttctc       900
     acgatcatca actccgtgat gtgtatcctt aatttcaata aaggattgaa gaatcacgtc       960
     caccctccta aaaaggggaa aacggtctcg ttggagctcg aatcccagga gacacctacg      1020
     cggttcttgt tgaactag                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page