(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE437

PENCW_13.PE437       Location/Qualifiers
FT   CDS_pept        join(complement(997463..997627),complement(996642..997385),
FT                   complement(994573..996591))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207662" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671905"
FT                   /orf_name="Pc16g04370"
FT                   /product="Pc16g04370 protein"
FT                   /protein_id="CAP93107.1"
FT                   /db_xref="InterPro:IPR013948"
FT                   /db_xref="UniParc:UPI00018315ED"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Q6"
FT                   /transl_table=1
FT                   /translation="MASRIVPNILDPLSSSALNKLHEPAPPPIKKRKRGEQEELNDTAG
FT                   QLATSSIVIRAHSASLSDEPLILEPITALPRTRLPLSWLDDTPASRSDEQAGGLFTADI
FT                   PTLEIDLRAKTEPTVLAVRLVPNGGLYIIERVKMGLYSLSKLARWIHEGNLVVAAKGWQ
FT                   GIDAAVDGEAVDETGGIPDGFDWWQVAQIDEPLSDVEMGEKSAGLDIAVVFGSSESDVG
FT                   NIETSFVGVVEHRGQSLAPSRSFDAAEGGAFLLPESQGLGDDAAAMEVDGVDSNVVDVQ
FT                   QSPEELLDGMRDNYLQALYVSKTSVAYFAKGPLTRCRTAFQARDSEQPHGSIELIESYR
FT                   EAILATKKMDLKYRETLPSAIRDAVLALSDDGAKSKKRKSKKKKMGKNGLYPEEEAFIH
FT                   RWWKDRILNESSAQETSREAESKKQISDLRLRETQLQILLILEVMVLEMTIASAEKNNT
FT                   SKEKDVNGEQGTSKKTKPKRSTDLNVLLELHLDRMCIWHAVTMEETSAADTAKASSFSG
FT                   SHLSGKKVESDAVRDFCTEVIIPFYAARLPDKCKLITRKFGVSGGISPAAKKTQSSSKS
FT                   HRVEPGAEVKRQQPAPKPRRTLQRVLTDDKAAASQARHPGLTRSNTAPSQHNAKRDTEP
FT                   LLPTVLSGSVRGGIQKAKRTENREVDLNAVARQHEAKLRKVQMLANQKKELDAAIDALR
FT                   KPNRELVSKDLADDASKRAMSGGGSSRKSRNPVRNPFGEGVQVMATPRGNRRKDAAPRS
FT                   LAPSRSFAGVENSPFGESPIMIPSSSRRAISFSGADSDPFNSHDNPPGGRSPRSSQPDG
FT                   AIQETPTRPSSKIFQSDTIAARRPSSSTGKGLFRVPNLPAPRSSTQPMVPGSPVHSRPK
FT                   NISAFTENLSTSSRQFSQSLNHARASAIMETPPRRQAPQSISTPTAVPFSLSLDAMVTD
FT                   NPRAHSPPAVMGTPVKGAAAVPVTPDKSQSKSIYEQLGWDDEMEF"
     atggcctcgc gtatagtccc caacatcctg gatccgctca gttcatccgc gctgaacaaa        60
     ctccacgaac cggcccctcc acccataaag aagcggaaaa gaggcgaaca agaggagcta       120
     aacgatactg ctggacagct tgctacctct tccatcgtca taagagctca ctcagcgtct       180
     ttatctgatg aacctttgat cctggaacca attaccgccc tcccccgcac aaggctgcct       240
     ctctcatggc tcgacgacac gcccgcctcc cgatctgacg agcaagcagg gggccttttc       300
     accgcggaca tccccacgct ggaaattgac ctgcgcgcaa aaacggaacc gactgtcctc       360
     gctgtgcgtc tcgtacccaa tggcgggctc tacattatcg agagggtgaa gatgggctta       420
     tactcgctct ccaagcttgc ccgatggata cacgagggca atctcgttgt tgcggccaag       480
     gggtggcagg gaattgacgc ggcggtggat ggcgaggctg ttgacgagac cggtggtatt       540
     cctgatgggt ttgactggtg gcaggttgct cagatcgacg agcccctctc ggacgtcgag       600
     atgggcgaaa agtctgctgg gctggatatt gcggttgtct ttggttcgtc tgagtctgat       660
     gtcggtaata ttgagacatc ctttgtgggt gttgtagagc accggggtca gtcgcttgct       720
     ccgtccagga gtttcgatgc cgctgaggga ggtgctttcc tgcttcctga atctcagggc       780
     ttgggggatg acgctgcggc tatggaagtt gatggtgtcg attccaatgt cgtggatgtg       840
     caacagtcgc ccgaggagtt gctggacggg atgagagata actatctgca ggctctctac       900
     gtttcaaaga cttctgtggc gtactttgcg aagggtccat tgacacgctg ccggactgct       960
     ttccaggctc gtgactcgga acagcctcac ggctcgatag agctgattga atcctaccgt      1020
     gaagctattc tcgctacaaa gaaaatggac ctcaaataca gagaaacatt gccatcggca      1080
     attcgtgatg cagttcttgc gctttctgat gatggcgcga aatctaagaa gcggaagagt      1140
     aagaaaaaga agatgggcaa gaatggtctt tacccagagg aggaagcatt catccacagg      1200
     tggtggaagg accggatctt aaatgagtct tctgcgcagg agacgtcgcg tgaagcagag      1260
     tctaagaaac aaatttcgga tctccgcctc cgcgagacgc aattgcagat cctgctgatt      1320
     ttggaggtca tggtgttgga aatgaccatt gcttcggcag agaaaaacaa caccagcaag      1380
     gagaaagatg taaatgggga gcaaggaaca tcgaagaaaa ccaagcctaa gagatctacg      1440
     gatttgaatg tactgcttga actccatctc gatcggatgt gcatttggca tgctgtgaca      1500
     atggaagaaa cttctgccgc tgacacagca aaggcttctt ctttcagtgg cagccatctt      1560
     tcaggcaaga aagtcgagag cgatgcggtg cgcgacttct gcacggaagt catcattcca      1620
     ttctatgctg cgcgcctccc ggacaaatgc aagttgatca cccgcaaatt cggcgtatct      1680
     ggtggtatct ccccagctgc taagaagaca caatcttcga gtaaatctca ccgcgtggag      1740
     cccggggctg aggtcaagcg acaacagcct gcaccgaagc cgcgacgaac attgcaacga      1800
     gtacttacgg acgataaagc ggcagcgtcc caggctcggc acccaggact gactcgatca      1860
     aacactgcac cgagccagca taatgcgaag cgcgatactg agcccttgct gcccactgtt      1920
     ctcagtggca gtgttcgggg tggcattcag aaagcaaaac ggacggaaaa ccgcgaagtt      1980
     gatcttaatg ccgtagcacg acagcatgag gcgaaattaa gaaaggtcca aatgcttgcc      2040
     aaccagaaga aagagctgga tgctgctatt gacgcgctcc ggaagccgaa cagagagctc      2100
     gtctccaagg atctggcaga cgatgcttcg aaacgagcta tgagtggcgg aggcagttcg      2160
     agaaagtcaa gaaaccccgt gcgcaatccg ttcggcgaag gtgtgcaggt catggcgact      2220
     cctcgaggta atcgaaggaa ggacgcggcc cctcgtagtc tggccccatc ccggtcattt      2280
     gccggtgtgg aaaattctcc attcggcgag tctcccataa tgatcccatc ctcaagtcga      2340
     cgggcgatct cattctctgg cgccgactcg gaccctttca attctcacga caatccaccc      2400
     ggtggacgaa gtccacgatc gagtcaacca gatggagcta tccaagagac tcccactagg      2460
     ccgtcttcca aaattttcca gagtgatacc atagctgcgc gtcggccgtc atcctccact      2520
     ggcaaaggcc tgttcagggt acccaacctc ccagctcccc gctcatctac acaaccaatg      2580
     gtcccaggct cccccgtcca ttcacgtcct aagaatatct ccgcattcac ggaaaatttg      2640
     tcgacatcgt ctcgacaatt cagccaatct ctcaaccacg ctcgcgcctc ggcaattatg      2700
     gagacgccgc ccagaagaca ggcaccgcag agtatatcta ctcccactgc tgtgccattt      2760
     tctctatcgc ttgatgccat ggtcaccgat aatcctcgcg ctcactcccc acctgcggtc      2820
     atgggaaccc ccgtcaaagg ggccgcagct gtgcccgtaa cgcccgacaa atcccaatcc      2880
     aagtcgatat acgagcagct gggctgggat gacgagatgg agttctaa                   2928
//

If you have problems or comments...

PBIL Back to PBIL home page