(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE44

PENCW_13.PE44        Location/Qualifiers
FT   CDS_pept        complement(97348..98151)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945521"
FT                   /orf_name="Pc16g00440"
FT                   /product="Pc16g00440 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP92714.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001831E9C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V5"
FT                   /transl_table=1
FT                   /translation="MGAEYCPVDDDGNYIQVDTIVASGDAALVVHREDMAIKMAIVYRH
FT                   YTLEQAEENRGIIRREQEVWRRIQPDFNTPVQGIIQCLGLRGDTIEMRYMPGGTLLKWL
FT                   QHRARPSIQLQKRWFRQLAIGLHNLHQHRVIHGDILSRNILMDGSLNVAICDLGASSLM
FT                   PMDTVMADAVDAYNCSIWTDLCQLGLVFYDIATGRTTGISLYDNGGSDNSVASFPSRDM
FT                   LPALSKRLWARDIIETCWREGGYGAAGAAGILAKLDKVKAPRRRR"
     atgggtgctg aatattgccc cgtcgacgat gacgggaatt acatccaggt tgatacaatc        60
     gttgcgagtg gcgatgcagc acttgtggtc caccgggaag atatggcaat caaaatggca       120
     attgtgtaca ggcattacac attggagcaa gcggaggaga accgcggcat catccgacga       180
     gagcaggaag tctggcggcg cattcagccc gactttaata ccccggtgca aggcatcatc       240
     caatgtcttg gacttcgcgg agataccatc gagatgagat acatgcccgg aggtacgctt       300
     ttaaagtggc tgcagcaccg agcgcgaccc agcatccagc tccagaagcg gtggtttcgc       360
     cagcttgcca tcggtctcca caaccttcat caacatcgtg tcatccacgg tgatattctt       420
     agtcgcaaca tactgatgga cggctcgttg aatgttgcaa tttgtgacct cggtgcatcg       480
     agcctcatgc ctatggacac tgtcatggcg gacgcggtgg atgcctacaa ctgctctatc       540
     tggacagatc tttgccagct gggcctcgtg ttctacgata ttgcgactgg gagaaccaca       600
     ggcatcagtc tatatgacaa cggtggcagt gacaactctg tcgccagctt tccatcgcgg       660
     gatatgctcc ctgccctgag caagcgactc tgggcccggg atatcattga gacctgctgg       720
     agggaaggtg gatatggggc tgcaggtgcg gcgggaattc tggccaagct ggataaagtg       780
     aaggctccgc gccgccgccg ttaa                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page