(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE442

PENCW_13.PE442       Location/Qualifiers
FT   CDS_pept        join(1008183..1008314,1008362..1008853,1008910..1008957)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234790" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128953"
FT                   /orf_name="Pc16g04420"
FT                   /product="Pc16g04420 protein"
FT                   /protein_id="CAP93112.1"
FT                   /db_xref="UniParc:UPI00018316DF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8R0"
FT                   /transl_table=1
FT                   /translation="MGEETAKPSGRKRGRPRTVTDDQEVPEVGQTLTLQLHMLIIINLX
FT                   RRRKQLRLAQQAYRKRKETTIGNLQNRVHELETGIENISHSFLSFSSLLIEEQLLSQYP
FT                   HIASALQIITQQCVSLAKAGSEDPSEGALPVVRATKESQTTNNNIPPTRVLDGAHSEGS
FT                   TDAEDIIRPAATGWPGPPTPPYQGQSISPFDLVMSSSTVQFPHTTPPLSNYSTLDPQSS
FT                   NIMPARQWNIAQRIVRTCSELGYRLLIDKPNSSLVQHIFGSALSLQQRNRLISALYAVM
FT                   QEDTGVLTDPKADVLHTLLSGHNMNPCSDEQLQISSRTWQIALESTSGEWMDAIGVQRY
FT                   LRDKRAIFENFTDSLGPHGYSVSPSLDITAFIKSLSKEAICVGNGPAFRRQSVDKALRL
FT                   ATISGPWDLDNFCNL"
     atgcgcccta gcaatcaagg ctcgctggac gttgtccctg ctaacatacg gattgttaga        60
     gaaatagatc gttccgatgc gtcttcagtt tttgagatag aactcgaagg gcagaaatat       120
     gctatgaaac tttttcacga caacggggat ctaggatttg ccgagaatgg ccgagacctg       180
     aatcgattcc gctgcgaact aaacgcctat atgaatcttt aggaacacgg tgtctgcgag       240
     aggggattcg tcccatactt ctacggctat attgatcgaa tcgaccctac cgcgttctat       300
     ctagcttttc aacatttcgc gcacgataaa tattacccta gagcaatact actcgaatat       360
     cttccgaatg cccaaagttt gaattgcgaa aactattttg aggcgtgtta tcataaagca       420
     atagagggta taaagcagat acacgctgct cacgttcact accaagatat ataccccaaa       480
     aatatactcg tcgttctagg cggtcaaaag cggatggtat gggtcgattt cgatgtcgca       540
     actacgtttt tgattgaggg tccagatgaa cagcggttga gtgaagaaga agatacgatt       600
     gttgcagagt ttggggaact tttgcgagca gaccaaagac aggggctctg taagaatact       660
     aagtggtatt ag                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page