(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE443

PENCW_13.PE443       Location/Qualifiers
FT   CDS_pept        join(complement(1010557..1010593),
FT                   complement(1010162..1010449),complement(1009988..1010062),
FT                   complement(1009749..1009930))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977837"
FT                   /orf_name="Pc16g04430"
FT                   /product="Pc16g04430 protein"
FT                   /protein_id="CAP93113.1"
FT                   /db_xref="UniParc:UPI00018316E0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8R1"
FT                   /transl_table=1
FT                   /translation="MDMDNTSRPAINIWTFFALAALDLAANAAAGPAAVATAAHVNGSP
FT                   LTARAMQIGALAGVTKSGVLAFVEFAAYAGLPTAAWILLALVASSFGICVLVTAEVSNL
FT                   VLGETPSALLVAAVVAAIPLSGECMGIYQSAGGLYGGQAQSQLFVLGLDALGGYVFARM
FT                   AHNGGQSLSLLYHESFGSTLFAAPVAPLDD"
     atggatatgg ataataccag tcgtcctgct atcaacatat ggacgttctt cgccctagct        60
     gcgctggacc tcgcagcaaa cgccgccgcc ggtccagctg cagtggcaac tgccgcgcat       120
     gtcaacggga gtccactgac agcgagagca atgcaaatcg gtgctctcgc tggagtcact       180
     aaatcagggg tgttggcatt cgtcgaattc gcggcgtacg cgggtttgcc aacagccgcg       240
     tggatactgt tagctttggt ggcaagtagc tttggaattt gtgtcctggt aacggcggag       300
     gttagcaatt tggttcttgg ggaaacacca agcgctttgc ttgttgcggc tgttgtcgct       360
     gctattcccc tttcgggaga atgtatgggg atataccagt ccgctggggg gctatatggt       420
     gggcaagctc aatcacaact ttttgttttg gggctcgatg ccttgggggg atatgtgttt       480
     gctcgtatgg cacataacgg aggtcagtcg ctgtctcttt tataccatga aagctttggg       540
     agcactctct tcgctgctcc tgttgcacct ctcgatgact aa                          582
//

If you have problems or comments...

PBIL Back to PBIL home page