(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE444

PENCW_13.PE444       Location/Qualifiers
FT   CDS_pept        join(1011311..1011364,1011460..1012401)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948774"
FT                   /orf_name="Pc16g04440"
FT                   /product="Pc16g04440 protein"
FT                   /protein_id="CAP93114.1"
FT                   /db_xref="UniParc:UPI00018316E1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8R2"
FT                   /transl_table=1
FT                   /translation="MNSTACVIEANPDVSGVGIRISIYALCLGGSIVNYLLRVFAPGED
FT                   QEEFSRGVSSALGLQGLALLCTAIYQTVRGELTLFHAICVVHLLAILGMDMVSKGRYSG
FT                   LGPWRLYFFSAIQVLVLAAFLALNVYVWVTAPQFGSQPQCNKNTVYVVFGVSINATSPV
FT                   FRYIILGTLGAIVAGYVLTFTCMLPCWCGYVVYRRRHPDAGNRTEGQKRGWMNWFVQVN
FT                   HPVYQDRRGPPERLYGQALLNFTLNKVAYCSFCIYLIVSLEQTIHRNNLDPEEEGWTFG
FT                   QVIAIFLLLGVANELLNVLLASWDRRQAESSQQLVQFRPGTGNTVHSLSS"
     atgaactcga cagcctgtgt catcgaggct aaccccgatg tatctggggt cgggattcgt        60
     atatcgatct acgccctctg cctgggcggg tcgatagtca actatctact ccgcgtattt       120
     gccccaggcg aagaccaaga ggagttctcg agaggggttt cctccgctct gggcttgcaa       180
     ggcctagccc tcctttgcac agcaatttac cagacagttc ggggcgagct gaccctcttc       240
     cacgcgatat gtgtcgtgca ccttctcgcc atacttggca tggacatggt gagcaaaggc       300
     cggtattcag gactcggccc atggcgactg tatttcttct ccgcaatcca ggtcctcgtt       360
     ttggcggctt tcctcgcttt gaacgtctat gtttgggtga cggcgccgca atttggcagc       420
     cagccccagt gcaacaagaa tacggtgtat gtggtctttg gcgttagcat caacgccact       480
     tctcctgtat tccggtatat catcctcggg acgttgggtg cgattgtggc tggttatgtt       540
     cttactttca catgtatgtt gccgtgttgg tgtgggtatg ttgtgtaccg gagacggcat       600
     cccgacgctg gaaacaggac tgagggtcag aagagaggtt ggatgaattg gtttgtgcag       660
     gttaaccatc ctgtttacca ggatcgtcgt gggccacctg agaggctgta tggccaggcg       720
     ctactcaact ttacgttgaa caaggtcgcg tactgttcat tctgcatata tttgattgtc       780
     tcgctggaac agactatcca tcgcaataac cttgaccccg aagaggaagg atggacattt       840
     ggacaggtta ttgcaatttt cttgttgctg ggtgtcgcta atgagctgct taatgttctt       900
     cttgcgagtt gggataggag gcaagctgaa agttctcagc agctggtgca gtttaggccg       960
     ggcacaggga acacggtgca ttccttatct tcttga                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page