(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE445

PENCW_13.PE445       Location/Qualifiers
FT   CDS_pept        join(complement(1015448..1015655),
FT                   complement(1013929..1015412),complement(1012927..1013871))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207596" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671906"
FT                   /orf_name="Pc16g04450"
FT                   /product="Pc16g04450 protein"
FT                   /protein_id="CAP93115.1"
FT                   /db_xref="InterPro:IPR022091"
FT                   /db_xref="InterPro:IPR022092"
FT                   /db_xref="UniParc:UPI00018316E2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8R3"
FT                   /transl_table=1
FT                   /translation="MAQNSQTQKPKWGVGSFFQQAVAGVESRLDHILMDEEGNQSNSTA
FT                   KPTETQGGEAPPTKAPVPCMRPTTPVSRSSSTARRNDRLQERLARAMVKQNTSSLSSKS
FT                   PQSRVSSLPASPVPSNGARSSMDMDSSVASVNSAVEDPKAPQSNDDSNPAKLASPRISY
FT                   DSGVSPRVSTEISVTDSAPRTSVDVVQPSIDSAKASQETSDSQRDSVLNDLDSGDSPRV
FT                   SVESPSEVPEEGENPDIARLRAERKTAESQWQEEMHGYIERIDALQSKLKYLAKDAAES
FT                   AKNAAASATPGSTQKQLLEKDEKIALLLEEGQKLSKSEMDHRTVIKKLRQQLTEHTKSQ
FT                   AEMKRKTDKLERDLANSEARAKRAEAAEKRATESLSSQTKSTKDLEAVTNERNALSQTV
FT                   QDIKSQLSRAVSRAEAAETKANSDALELEKQRARELDEELCNLKIEHDISEERSKREIT
FT                   ELKEKIDQEKERARMLEAELKGEQSVLESKMESLRSRAEEASSGATGETQAKLLRQIET
FT                   LQTQYAAASENWHTLEGSLLSRLASVEKERDDAGRREIDLRKKIREMNHKLKKFEEELD
FT                   NAKEAEHDLSSRLEERMEELQKLQQKLEKAADDLASTQKDMAEQKKTCDTTWAQKLEEE
FT                   RAKWREQVNSPSQLRGVSPVASLRRSSTLDAMTPGQPECRPPSRRSSTMAFASPEIGTP
FT                   PRQNSYPASITQATLSPPHINTNPSLMAAPSITFEPDEYFEDSGTPATPSAYGGTQAHP
FT                   PRGINDIISESTVGAGPSVQLVERMSATVRRLESERAGSKDELARVTTQRDEARQQVVD
FT                   LMRELEEKQLSDSRVQELEAELEDLDQRYQTTLEMLGEKSEQVDELNADIADLKKIYRE
FT                   LVDSTMK"
     atggcgcaaa actcgcagac gcaaaagcca aaatgggggg tgggttcttt tttccagcaa        60
     gcagtagccg gcgtcgagtc tcggctggat cacatcttga tggatgagga gggaaaccaa       120
     tccaactcta ctgcaaagcc cactgaaacc cagggcggag aagcaccacc gacaaaggct       180
     cctgttcctt gtatgagacc cacaacaccg gtttcccgca gttcatcgac cgcgcgaaga       240
     aatgaccgac ttcaggaacg tctagcccga gctatggtaa agcaaaatac ctcaagtcta       300
     tcttccaagt ctccacagag ccgagtctca tcgctgcctg ctagtccagt acctagcaat       360
     ggggctcggt cgagtatgga catggattcc agcgttgcat cggtgaatag tgcggtggaa       420
     gaccccaagg ctcctcagtc gaatgatgac agcaacccag ctaagttggc ctcaccgaga       480
     ataagctacg actccggggt atcaccgcgt gtttcaacgg agatcagtgt cacagactcc       540
     gcgcccagga catccgtaga tgtggttcaa ccatcaatcg actcagccaa agctagtcaa       600
     gaaacgtcag attcgcagcg cgattcggta ctgaatgatc ttgattcggg tgatagtccg       660
     cgggttagcg ttgaatcgcc atcagaggtg cccgaggagg gcgaaaaccc agatatcgct       720
     cgcttgcggg ctgagcgtaa aactgccgag tctcaatggc aagaagagat gcatggttat       780
     attgaacgta ttgacgcgtt gcagtcgaaa ttgaaatacc tcgctaagga tgctgcggaa       840
     tcggctaaaa atgctgcggc gagtgctacc ccagggagta cgcaaaagca actcctggag       900
     aaagatgaga agatcgcatt gctccttgaa gaagggcaga agctgtccaa gtcggagatg       960
     gaccaccgca cggtgatcaa gaaattgcgt cagcaactta ccgaacacac caaatctcag      1020
     gctgaaatga agagaaagac ggacaagctt gagcgggact tggccaactc cgaagcaaga      1080
     gccaagcggg cagaggccgc agagaagagg gcaaccgagt ctttgtcatc ccaaacgaag      1140
     tcgactaaag acttggaagc tgttacgaat gaacgcaatg cgctcagtca gactgtccaa      1200
     gacataaaat cgcaattgag tcgggctgtt tcccgcgccg aagccgccga gacaaaggcg      1260
     aactctgacg ctctagagct agagaagcaa cgggcgaggg agctagacga ggagctatgc      1320
     aacctgaaga ttgagcacga cattagtgaa gaaagatcca agagggaaat taccgagttg      1380
     aaggagaaga ttgaccaaga gaaagaaaga gcccgaatgc tcgaggctga attgaaaggc      1440
     gaacagtctg tcttggaaag caagatggag agtcttcgct cccgcgcaga ggaagcttca      1500
     tcgggggcaa caggagagac gcaggccaaa cttcttcgtc agatcgagac cctgcaaact      1560
     caatatgctg ctgctagtga aaactggcat acactagagg gctctttgct ctcacgcctg      1620
     gctagtgtgg agaaagaacg cgatgatgct ggtcgacgtg agatcgacct tcggaagaag      1680
     attcgagaga tgaaccacaa gttaaagaag ttcgaagagg aactagataa cgccaaagaa      1740
     gctgagcacg atttgagcag caggctagag gaacgcatgg aagagctgca gaagcttcaa      1800
     caaaaactcg agaaagcggc agatgacctt gcctcaacgc aaaaggacat ggccgagcag      1860
     aagaaaacat gcgacacaac gtgggcgcag aagctcgagg aggagcgggc caagtggaga      1920
     gagcaggtga actccccgtc gcaactgcgc ggagtatcac ccgttgcatc tctacggcga      1980
     tcgagtaccc tcgacgccat gaccccaggg cagccggaat gccgccctcc tagccggcgc      2040
     tcatctacta tggctttcgc ctcaccggag attggcacgc cgcctcgaca aaactcctac      2100
     cctgcctcaa tcacccaagc tacgctttct ccgccacaca tcaacacgaa tccctcactc      2160
     atggcagcgc cctccatcac ctttgagccg gacgagtatt tcgaagattc tggtactcct      2220
     gccactcctt cagcctacgg cggtacccaa gcacatccac cgcgcggtat caacgacata      2280
     atatccgagt caactgtcgg cgccggccct tctgtgcagc tggtcgagcg catgagtgcc      2340
     acagtccgcc gccttgagag cgagcgcgcc ggatctaagg acgagcttgc ccgtgtgacc      2400
     acacagcgcg acgaagcccg gcaacaagtt gttgatctca tgcgcgagct cgaagagaag      2460
     cagctttcgg attcccgtgt gcaggaactc gaagctgaac tcgaagacct tgatcagcgc      2520
     taccagacca ctcttgagat gctgggcgaa aagagcgagc aggttgacga actcaacgct      2580
     gatatcgctg atctcaagaa gatctaccgc gagctagttg acagtactat gaagtga         2637
//

If you have problems or comments...

PBIL Back to PBIL home page