(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE446

PENCW_13.PE446       Location/Qualifiers
FT   CDS_pept        join(1016199..1016493,1016552..1017077,1017139..1017751)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207607" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948775"
FT                   /orf_name="Pc16g04460"
FT                   /product="Pc16g04460 protein"
FT                   /EC_number="3.6.3.6"
FT                   /function="binding"
FT                   /function="hydrogen-exporting ATPase activity,
FT                   phosphorylative mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="vacuolar proton-transporting V-type
FT                   ATPase, V1 domain"
FT                   /protein_id="CAP93116.1"
FT                   /db_xref="GO:0000221"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0008553"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="InterPro:IPR004908"
FT                   /db_xref="InterPro:IPR011987"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00018316E3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8R4"
FT                   /transl_table=1
FT                   /translation="MSLEPPTYLSSLQNNIRARPIPWEGAVRAGNITDDHLKKIKAVDK
FT                   VRKDQRRQTIEGDLAAYTGLLAGGAQGKSVLDSASRRTDIVQYILVLASDLIQDVPSLA
FT                   SSLVSHPEPYKPFLPFLQHSTNAEDPIPLLTSTFLTALVSHSLVASSKPAPRDNEALPQ
FT                   LYTYLSTLTKNQDSGLQDIGVQGFSELLRTSRAREIFWAQRQETLAPLIDTLRAAAGAK
FT                   DNVGNASTLGSSSRSVEPGLAGGVGLQLLYRVLLVLWQLAFEGALVGDELQENYEIIQL
FT                   YIHLLRLSPKEKTTRLLVATLYNLCSSNRTTLLPIAVFLRLPALLTNLSGRHLTDPDLL
FT                   EDLNALSSMLEEYTKTQTTFDEYAAEVQTGHLRWSPPHKNPTFWKDNARRIVEESNGAL
FT                   PKKLAEILSKSWDNDKQVLAIACSDVGHLVKEVPERRGQLERLGLKTRVMELMVDQDES
FT                   VRWESLHAVGEWLRYTFEG"
     atgtcgctgg agccacccac ttacctcagt tccctccaga ataacattcg agctcggcca        60
     attccatggg agggtgccgt ccgagcgggc aacatcaccg atgaccacct gaagaagatc       120
     aaggcggtgg acaaggtgcg caaggatcaa cgccgccaaa cgatagaagg agatcttgct       180
     gcatacacag gtctgttggc tggtggtgca cagggaaaga gtgtcttgga ctcggcctct       240
     cgaaggaccg atatcgtgca gtatatactg gtgctggcct cggacttgat tcaagatgta       300
     ccttctttgg ccagctcgct tgtttctcac ccagaaccgt acaagccgtt cctaccgttc       360
     ctgcagcatt cgacaaacgc cgaagacccc atccctctgc tcacgtccac cttcctcacg       420
     gcgctcgtat cgcacagtct cgttgcttca tccaaacctg caccgcgcga caatgaagct       480
     ctcccacagc tctacaccta tctctctacc ttaaccaaga accaggacag tgggctccag       540
     gacattggtg tccaaggatt ctcagagctg ttgagaacta gccgagctcg agagatcttt       600
     tgggcgcaac gtcaagagac cctggccccc ttgatcgaca ctcttcgagc tgcggctggg       660
     gctaaagaca acgtcggcaa cgctagcaca ctgggaagca gcagtcgcag cgtcgagcct       720
     ggtctcgccg gtggtgttgg acttcagctt ctatatcggg tgctccttgt tctgtggcag       780
     cttgcattcg agggcgcact cgttggcgat gaacttcaag agaactatga aattatccaa       840
     ctctacatcc accttctgcg tctctcaccg aaagaaaaga ccacccgctt gcttgttgca       900
     actttgtaca atctttgctc cagcaaccgg accactctgc tacccatcgc cgtgttcctt       960
     cgactccccg ccctcctgac caacttgtct ggtcgtcatc tgaccgaccc cgacctgctt      1020
     gaggatctca acgcgctctc ttccatgttg gaggagtata ccaagacaca gaccaccttt      1080
     gacgaatatg ccgccgaagt ccagacgggc cacctgcgct ggtcgccccc tcacaagaac      1140
     ccgaccttct ggaaagacaa cgctcgacga atcgtagagg agtcgaacgg tgctttgccc      1200
     aagaaactag ctgaaattct gtctaagagt tgggataacg acaagcaggt gctggctatt      1260
     gcttgcagcg acgtagggca cttagtgaag gaggttcccg aacgccgtgg gcagttggag      1320
     cgactgggcc taaagacgcg ggtgatggaa ttgatggttg atcaagatga atcggtacgg      1380
     tgggagagct tgcatgcggt cggcgagtgg cttcgatata cctttgaggg ctga            1434
//

If you have problems or comments...

PBIL Back to PBIL home page