(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE447

PENCW_13.PE447       Location/Qualifiers
FT   CDS_pept        join(1018171..1018366,1018417..1019703,1019752..1019783)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207618" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948776"
FT                   /orf_name="Pc16g04470"
FT                   /product="Pc16g04470 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP93117.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00018316E4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8R5"
FT                   /transl_table=1
FT                   /translation="MSRSFTGCKRCKARRQKCDEQRPNCGRCQTAGEQCQYAMQLQWGG
FT                   RAFSRSRFGACVGTGGMQRLEYSPGEFIYTTKTAVQPASASTGSDLTLSQPVDPFSSLS
FT                   SSQKALLHHFINDASQITACHSGMQQDICRMLIPMALQTPSLLYATTALSAIHIQALHN
FT                   QSESVKSAPDIARLMALSLEHFRTELQNPSSKDPEALVATARTLCLAEIHSGAINPNSW
FT                   RAHIDGARALMRASDAAGEDSLRSTSGFRRYLDRWYWSIVSLTALTGNGPPIGDISDFA
FT                   SSDLMGLGGSTDYLDDYWGFSVDLAAVFRQIGAAAWRSHEVEKATQGFVAGEVDASVED
FT                   DAASLESAVRQLMDRDSTTQPSFYPSAAKSLSAESAQQLLLCNEAFQHSALIQIHRRLR
FT                   KTPSMSPEVQQSVQRILECTAQIGPSSGLSPWVMLTTPIFIAGCEARGQDRDTVRQLLS
FT                   SLHDTIRVPNVLQSLKFLEQYWANQLSEEEDWSHFLERMQFDFIPY"
     atgtcgagat ccttcacagg ctgcaagaga tgtaaggcac gccgacaaaa atgtgacgag        60
     cagagaccga actgcggtcg ctgccagact gccggcgagc aatgccaata tgcaatgcag       120
     ttgcagtggg gtgggcgggc gttctcgcga tcccggtttg gtgcttgcgt cgggacagga       180
     ggcatgcaga gactcgaata ttcaccaggg gagttcatct acaccaccaa gacggcggtg       240
     cagccagcca gcgccagtac cggatcagat ctcactctgt cgcaacccgt cgatcccttc       300
     tcgtccttgt cgtccagtca aaaggccctg ttgcaccatt ttatcaacga tgcttcacag       360
     attacggcgt gtcattcggg aatgcaacag gacatatgtc gcatgttaat cccaatggcg       420
     cttcagactc cctcattact gtacgctacc accgccctat ccgcgatcca tatccaagcc       480
     ctacacaacc agtctgagag cgtaaaatca gcaccggata ttgcccggtt aatggctctc       540
     agtctcgaac atttccgaac agagctgcag aatccctcat cgaaggaccc cgaggcgctg       600
     gtggcgacgg ctcggacgct ctgcctagct gagatccatt ccggggcgat aaacccgaac       660
     tcatggagag cacatattga cggggcgaga gcattgatga gggcatcgga tgccgctggg       720
     gaggattcct tgcggtctac aagcggcttc cggcggtatt tggatcgttg gtactggtcg       780
     atcgtgtcgc ttacggcact gacgggcaat ggtccaccta ttggagatat ctcggacttt       840
     gcctcctctg atttgatggg gctgggcggg tctactgatt atctagatga ttattgggga       900
     ttcagtgtcg accttgcggc tgtctttagg cagatcggcg ccgccgcctg gcgaagccac       960
     gaagtcgaaa aggctactca gggctttgtc gcaggagaag ttgatgccag tgttgaagat      1020
     gatgctgcgt ctttggagtc cgcagttcga caactcatgg atcgtgactc aaccacgcag      1080
     ccctcgtttt accctagtgc cgcaaaaagc ttatctgcgg agagcgcaca gcagctccta      1140
     ctctgcaacg aggcattcca acacagtgcg cttattcaga tccaccgacg acttcgaaaa      1200
     acgccatcta tgtcgccaga agtgcagcag tcggtccaac gtatcctgga atgcaccgcg      1260
     cagattgggc catcatcggg tctctcgcct tgggtgatgt tgacgacacc gatttttatt      1320
     gcgggctgcg aggcgcgcgg tcaagatcga gatacggtcc gacaactgct gtcgtccttg      1380
     catgacacta ttcgcgttcc gaacgttctt caatcattga aattcctcga gcagtattgg      1440
     gctaatcagc tgagtgagga agaagactgg agccatttcc tcgaacgaat gcagttcgat      1500
     ttcatccctt actag                                                       1515
//

If you have problems or comments...

PBIL Back to PBIL home page