(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE448

PENCW_13.PE448       Location/Qualifiers
FT   CDS_pept        join(1020598..1021414,1021480..1022405)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128954"
FT                   /orf_name="Pc16g04480"
FT                   /product="Pc16g04480 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP93118.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00018316E5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8R6"
FT                   /transl_table=1
FT                   /translation="MASIIRDAPFGQLVRLLTNNKYFQYPEEKPDFKLPDTWLQLLNSN
FT                   GDEDDEKKAIQQDSNRSPEDSEPLSRASTQASIEFTEARLEADEQHEIEKIKSIPIAPK
FT                   KTKDGSILVDWYYTDDLENPHNWSNGKRAFITILICLYTFVVYTTSAIYTSSTQGVMKE
FT                   FGVSTLVATLGLSLYVLGYGTGPLVFSPLSEIPVIGRNPVYIITMFLFVIISIPTAFVG
FT                   NFAGLMVLRFLQGFFGSPCLASGGASIGDMYSLMNLPFAMMAWVAAAYCGPALGPLLSG
FT                   FAVPVKGWRWSLFESIWASAPVFILMFMFLPETSSATILLRRAARLRKIHNTNRFMSQS
FT                   ELDQRNMRVSDIAVDALIKPMEITIKDPAVLFVQIYTAIIYGIYYSFFEVFPLVYPVDY
FT                   NMNLGQIGLVFLCVLVSCIIGIAVYASYIHFWMNRRIRRFGFPVNEKLLIPALPASFGP
FT                   LIGLFLFAWTARASIHWIAPTIGITIYGATVFIVMQCIFMYIPLTYPKYAASLFAANDF
FT                   FRSALACGSVLFAHPLFGNLGVARGVSLLGGLSVIGIIGIWLLYFYGGRLRALSKFAIS
FT                   DPVE"
     atggcatcta tcattcgaga tgccccattc gggcagcttg ttcgtctgtt gacgaacaat        60
     aaatacttcc aatatcccga agaaaagcct gacttcaagc ttcccgacac atggctccaa       120
     ttgttgaact ccaatggaga cgaggacgac gaaaagaagg ccatccaaca agactccaac       180
     agaagccctg aagatagtga gcccctaagc cgggcgtcga ctcaagcatc catagaattc       240
     accgaagctc gccttgaggc cgacgaacaa catgaaatcg agaaaataaa atccatcccc       300
     atcgccccca agaaaacaaa agatggttcc atccttgttg attggtacta taccgatgat       360
     ttggagaacc cacacaactg gtccaatggc aagcgcgctt tcattactat tttgatctgt       420
     ctatacacct tcgtcgtgta taccacttct gcgatctaca cctcctcaac acagggtgtc       480
     atgaaggagt tcggcgtgag caccttggtc gctactttgg gattgtcact ttatgttctg       540
     gggtatggca ccgggccatt ggtcttctct ccactgagtg agatccccgt gattggacgc       600
     aatccagtct atatcatcac gatgttcctc ttcgtgatca tctccatccc aacagccttt       660
     gtgggcaact tcgccggtct gatggtgctg cgctttctgc aaggattctt cggctcgccc       720
     tgtctagcat ctggaggtgc ttccatcgga gacatgtata gcctaatgaa cctgcctttt       780
     gccatgatgg cttgggttgc tgcagcctac tgtggacccg ccctcggccc tctcctcagc       840
     ggcttcgccg tccccgtcaa aggctggcgc tggtccctct tcgaatcaat ctgggcctcc       900
     gccccagtct tcatcctgat gttcatgttc ctcccagaaa ccagcagcgc aacaatcctc       960
     ctccgccgcg ccgcccgtct ccgcaaaatc cacaatacca accgcttcat gtcgcagtcc      1020
     gagctcgacc agcgaaacat gcgtgtttca gacatcgccg tcgacgccct aatcaagcct      1080
     atggaaatca ccatcaagga tcccgccgtc ctcttcgtgc aaatctacac agccatcatc      1140
     tacggcatct actactcctt cttcgaggtc ttccctctgg tctacccagt cgactacaac      1200
     atgaacctcg gccagatcgg tctggtcttc ctgtgtgtgc tggtttcatg cattatcggg      1260
     attgccgtct acgccagcta catccacttc tggatgaacc ggcgcatccg tcgcttcggc      1320
     ttccctgtaa atgagaagct tcttatcccc gcgctgcctg cttcctttgg tcctctcatt      1380
     ggtcttttcc tttttgcttg gactgcgcgt gcgtctatcc attggatcgc gcctaccatt      1440
     ggtattacca tctatggtgc tacggttttc atcgtcatgc agtgcatctt catgtacatc      1500
     ccgctcacct accccaagta cgcggctagt ctgttcgcgg cgaatgattt cttccgcagt      1560
     gcgcttgctt gtggtagtgt gctgtttgcg catccgctgt ttgggaactt gggtgttgct      1620
     cggggtgtca gtcttcttgg tggactgagt gtcattggga ttattggtat ctggttgctt      1680
     tacttctatg gtggcaggct tcgtgctttg agcaagtttg ctatctcgga tccggtggaa      1740
     tga                                                                    1743
//

If you have problems or comments...

PBIL Back to PBIL home page