(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE449

PENCW_13.PE449       Location/Qualifiers
FT   CDS_pept        join(complement(1024131..1024460),
FT                   complement(1023181..1024079),complement(1022961..1023126))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000199710" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948777"
FT                   /orf_name="Pc16g04490"
FT                   /product="Pc16g04490 protein"
FT                   /function="acid phosphatase activity"
FT                   /protein_id="CAP93119.1"
FT                   /db_xref="GO:0003993"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="UniParc:UPI00018316E6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8R7"
FT                   /transl_table=1
FT                   /translation="MRSLVLLSAASALAQTPGDSFYPPKLNDTSYISNSSIETYGGIYE
FT                   APTNGPTGGNPYGTYDYCSMPHPRSEEYELPEALANGSTEGKLVYLEYLQRHQRRTPYN
FT                   ILPGGENQEYHCDDVRPYLYAGPNSASGIQPMPMYAQTYQDPSNPFTPGVNGTCQYPQM
FT                   TIGGVQDGYQHGKDLWGVYGEKLGLIPAKPNSRVWFRSSESALTQASAGAVLRGMWPGH
FT                   KEALPLHQMVTSVNTVNSGYSCPAVSSTLSSMKTTTQWKEHLAVTEELRSELGAMLGAT
FT                   ESSWQSTFDHFADNFQGRLCNGYDLPCSLTNSSSCVTMQMAQEVFRAGDWEWNYYWRTN
FT                   PDVVKYIQVVEGLFIGEIISRLQAVLDGNSSLDYSHIFVHDGDIGPILGALGIETLRWP
FT                   GMASNIAFEVWETKDSKDEASFYARVLYSSHPIRSIHGVLDWVPLSKLIDIMSPYVPED
FT                   ITSLCG"
     atgcgcagtc tcgtcttgct ttccgcggcc tcggcgctgg ctcaaacccc gggggactcc        60
     ttctatcccc caaagctgaa tgatacatca tacatcagca acagctcaat tgagacatat       120
     gggggtattt acgaagctcc aaccaatggt ccgaccggag gcaaccccta cggcacctat       180
     gactactgct ccatgccgca tcctcgttca gaggaatacg agctccctga agctctagcc       240
     aatgggtcaa ctgagggaaa gcttgtgtat ttggagtatc tacagcgtca ccagcggcga       300
     actccgtaca acattctccc gggtggggag aaccaagaat atcactgcga cgatgtgcgt       360
     ccgtatctct acgcaggccc gaacagcgca agcggcatcc agcccatgcc aatgtacgca       420
     cagacatacc aggaccccag caaccccttc acacccggcg tgaacggcac ctgtcagtac       480
     ccgcagatga ccatcggagg agtccaggac ggatatcagc acggcaagga cctctggggc       540
     gtttacggcg agaaactcgg cttgattccc gcgaagccaa acagccgcgt ctggttccgc       600
     tccagcgagt cagctctcac ccaggcctcg gctggcgcgg tcctgcgcgg catgtggcct       660
     ggccacaagg aagctctacc cttgcaccag atggtcacgt ctgtcaatac cgtcaatagc       720
     ggatactctt gccctgctgt cagctctact ctatcgagta tgaagactac cacgcagtgg       780
     aaagagcatc ttgctgtcac cgaggagttg cgctcggagc tgggcgctat gttgggcgcg       840
     acggagagtt cgtggcagag tacctttgac cactttgcgg ataacttcca gggtcgtctc       900
     tgcaacggct atgatctgcc ctgcagtctt accaattcgt catcctgtgt cacgatgcag       960
     atggctcagg aagtcttccg tgctggtgat tgggagtgga attactactg gcgcacgaac      1020
     ccagatgtgg tcaagtacat tcaggttgtc gagggcttgt ttattggcga gatcatctct      1080
     cgtctgcaag ctgtcctgga cgggaattct tcactcgatt acagtcacat cttcgtccat      1140
     gacggggata tcggtcctat cctgggtgct ttgggaatcg agacgcttcg ctggcctggt      1200
     atggcgtcga acattgcttt cgaagtttgg gagacgaaag atagtaaaga tgaggcttcc      1260
     ttctacgccc gggttttgta tagtagccat cccatacgaa gcatccacgg tgttcttgac      1320
     tgggtccccc tctcgaagct gattgatatc atgagcccct acgtccctga ggatataact      1380
     tctctctgtg gataa                                                       1395
//

If you have problems or comments...

PBIL Back to PBIL home page