(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE45

PENCW_13.PE45        Location/Qualifiers
FT   CDS_pept        join(complement(100521..100697),complement(99550..100455))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000294667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945522"
FT                   /orf_name="Pc16g00450"
FT                   /product="Pc16g00450 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92715.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831155"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V6"
FT                   /transl_table=1
FT                   /translation="MSSTDYKFEGWVGLGPEAAQGKMVWQEFEPKPWEETDVDIKVTHC
FT                   GICGSDLHTLRSGWGPTNYPCCVGHEVVGIAVRVGTQVKGDIKVGDRVGVGAQSGSCEN
FT                   KDGDCESCASGLEQHCSKMVGTYNGTYANGGKSYGGYSTYNRSPSHFVIKIPDAISSAD
FT                   AAPMLCGGITTYSPLKRNGCGPGKTVGIVGVGGLGHFAILFAKALGADRVVAISRKSDK
FT                   KEDALKLGADDFIATGEDEDWATRHASSLDLIISTASSSKMPIVQYCGLLRVHGTFIQL
FT                   GAPEDGALEIPAFVLIIKGLKLGGSLIGSPDEIREMLELAAAKGVKPWIQERPMKDANQ
FT                   AIVDMDKGDARYRYVLTNEQ"
     atgtcttcta ccgattacaa gttcgaagga tgggtaggcc tcggccccga agccgcccag        60
     ggcaagatgg tctggcagga attcgagcct aagccatggg aggagaccga tgtcgatatc       120
     aaggtcactc actgtggtat ctgtggctcg gatttgcaca ccctgcgcag tggatggggc       180
     cccaccaact acccttgctg cgtcggccac gaggttgtcg gaatcgctgt ccgcgtcggc       240
     acccaggtca agggagatat caaggtcggt gatcgtgtcg gtgtcggcgc gcagagcggc       300
     tcgtgtgaga acaaggatgg cgactgtgaa tcctgcgcgt ctggtctgga acaacactgc       360
     agtaagatgg tcggcacata caacggtacc tatgccaacg ggggcaagtc gtacggtggt       420
     tactccacat acaaccgctc tccttcgcac ttcgtgatta agatcccgga tgctatctcc       480
     tctgccgatg ccgcgcctat gctctgcggt ggtattacta cctactcgcc tctcaagcgg       540
     aatggctgtg gccccggaaa gactgtcggt attgttggcg tcggtggtct tggtcacttt       600
     gctatcttgt tcgccaaggc gctcggtgcg gatcgcgtcg tcgccatctc ccgcaagtct       660
     gacaagaagg aggatgcact caagcttggt gcggatgact tcatcgctac cggtgaggac       720
     gaggactggg ctacccgcca cgctagctct ctcgacttga ttatctccac tgcctcttcg       780
     tccaagatgc ctattgtcca gtactgtggt cttctgcgtg ttcacggtac tttcattcag       840
     ctcggtgccc ccgaggatgg tgctcttgag atcccggcgt tcgtgctcat catcaagggt       900
     ctcaagcttg gtggctcgtt gattggtagc cccgatgaga tccgggagat gttggaactg       960
     gctgctgcta agggtgtcaa gccttggatc caggagcgcc caatgaagga tgccaaccag      1020
     gccattgtgg atatggataa gggtgatgcc cgttaccgct atgttctcac gaatgagcag      1080
     taa                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page