(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE450

PENCW_13.PE450       Location/Qualifiers
FT   CDS_pept        join(complement(1025681..1025912),
FT                   complement(1025300..1025637),complement(1024928..1025239))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201342" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948778"
FT                   /orf_name="Pc16g04500"
FT                   /product="Putative uncharacterized protein Pc16g04500 "
FT                   /protein_id="CAP93120.1"
FT                   /db_xref="UniParc:UPI00018316E7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8R8"
FT                   /transl_table=1
FT                   /translation="MSRPRRNVNFYDGLTGAHLGGVRQNGSITNANFFHMLMDVLLEAD
FT                   GIISIDHRGTGQRMPMNTDRLAEGDYDIFCPRGGIRLTEENFVRRVYSRSRSSRENSFR
FT                   DSVRARDGKCVLTGVVNNGASEGMWTGFEAAHIFPLERRELWRQCNFDRLITRPGRNPI
FT                   NSVQNGMLVSSSVHRLFDSFLISVNPDDCYKITDFAQNNWQADGRVLDIVCLNPNNPDR
FT                   VADDLLRWHFRQSVLANMKEAGEPIFEHDFPPGTDMVKEILQGPFPAERMELELFSRLQ
FT                   STPQENDDESAY"
     atgtctcgcc ctcgacgaaa tgtgaacttt tacgacggtt taacgggtgc tcatctcggc        60
     ggtgtccgac agaatggatc tatcacaaac gctaattttt tccacatgct gatggatgtc       120
     ttactcgaag ccgatggaat aatttcaatc gaccacagag ggaccggaca acgaatgccg       180
     atgaacactg atcgcttagc cgaaggggat tatgatatct tttgccctcg aggtggtatc       240
     agactgaccg aagagaattt cgtgcgacga gtctactcac gtagccgaag tagccgagag       300
     aactcctttc gagattctgt acgcgcgcga gacggaaaat gcgttttgac tggagtggtg       360
     aacaatggcg caagtgaggg tatgtggacc ggcttcgagg ccgcgcatat tttcccattg       420
     gagcgccggg aactctggcg ccaatgtaac ttcgaccgtc ttattacgcg tcccggacga       480
     aatccaatca actcagtgca aaatggcatg ttagtctcgt catcggtaca caggctattt       540
     gatagctttc tcatttccgt taatcccgac gattgttaca aaatcacaga ttttgctcaa       600
     aataactggc aggctgatgg tcgagtactc gacatcgtgt gcctaaatcc gaacaacccc       660
     gaccgtgtcg cagatgactt gcttcgttgg catttccgcc agtctgtgct tgccaatatg       720
     aaagaggctg gcgagcccat cttcgagcac gattttcccc ccggcactga tatggtgaaa       780
     gaaatcctcc aaggcccatt tccggctgag cgcatggaac tggagctgtt ttctcggtta       840
     caaagcaccc cgcaagaaaa cgacgatgaa tctgcctact ag                          882
//

If you have problems or comments...

PBIL Back to PBIL home page