(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE451

PENCW_13.PE451       Location/Qualifiers
FT   CDS_pept        join(complement(1027830..1028033),
FT                   complement(1026210..1027751))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204544" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824611"
FT                   /orf_name="Pc16g04510"
FT                   /product="Pc16g04510 protein"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP93121.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI00018316E8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8R9"
FT                   /transl_table=1
FT                   /translation="MQPGAERGPKHSVYTLPEIPLVNRHADDPRKLRVAVIGAGLSGII
FT                   AGVLLPAKVPGIDLTIFEKNADVGGAWFENIYPGVRCDIPAHVYQSSFEPNTQWSEVYA
FT                   QGAEIRDYWSEAARKYDVYTYLKLSQRVEHLAWDNEQSIWLVKVENLLTGEVYVHEADF
FT                   VLTAIGRFNAWKLPSYQGIEDFKGVIRHASNWDPTFDVSGKRVAVIGNGSTGIQLTTNL
FT                   QSQVARLDHYVRSKTWIATDFIGDSTALQSFPIPKETRDSFNDIDVYLKYRKSIEQSFW
FT                   RGFDGWLKGSESNEHARGEYIRHMKKRLAKKPELAESIIPEFSPSCRRLTPGPGYLEAI
FT                   TAENVDYIQTPIRRFTETGIETVDGKHREVDAVFAATGANIDAVPPFSITAHGKDLTEL
FT                   WSEGGEYGFPYNYIGIATPGFPNLLFILGPNGAGRSGTVPHNVEVQVTLFARILRKVGR
FT                   EGIKTIQPSKKAADDFVQYSDAFWKTTVLSEDCQSWYNGGKPGSRIHGLWPGSSSLVSI
FT                   IYNDPRWEDWEYEYLNDTGNRLAWYFGNGGTKMEADPEHDITSYLIDPAEIDLKKLHEG
FT                   WWSVP"
     atgcagccag gagctgaacg aggaccgaaa cactctgtat acactcttcc cgagattccc        60
     ctcgtcaatc gccatgccga tgacccacga aaattgagag ttgcagtcat tggtgcagga       120
     ttgtctggta tcatcgctgg ggtactgctt ccagccaaag ttcctggtat tgacttgacc       180
     atcttcgaga agaacgcaga tgttggaggc gcgtggtttg aaaatattta tcctggtgtc       240
     cgatgtgata ttccggcaca tgtataccag tcatcgtttg aaccaaacac gcagtggtcc       300
     gaggtgtatg cccaaggcgc agagatcaga gactattggt cagaggctgc gcgcaaatac       360
     gacgtgtata catatctgaa gctctcccag cgcgttgaac atctggcatg ggacaatgaa       420
     cagtccatct ggcttgtcaa ggttgaaaat cttctgacag gagaagttta cgtccatgaa       480
     gctgatttcg tactcacggc gattggacgg ttcaacgcct ggaaactgcc cagttaccaa       540
     ggtattgaag acttcaaagg agtgattcga cacgcgtcga actgggatcc gacattcgac       600
     gtttcaggga agagagttgc agtcattgga aatgggtcaa cgggcattca attgacgaca       660
     aatttacaga gtcaggttgc acgcttggat cactacgtac gtagcaagac atggatagcg       720
     acagacttta ttggtgactc gacagcccta caatcatttc cgatacccaa agagaccaga       780
     gactcattca atgatatcga cgtatacctc aagtaccgca aaagcattga acagagtttc       840
     tggcgcgggt ttgacggctg gcttaaaggc tctgaaagca atgagcacgc tcggggagag       900
     tatattcggc atatgaagaa acgcctcgcg aagaagccag aactggccga aagcatcata       960
     ccggaattct ctccaagttg tcgtcgcttg acgcctggtc ctgggtactt ggaggccatc      1020
     actgcggaaa acgtcgatta catccagacg ccaatcaggc gatttacgga gaccggcata      1080
     gaaactgttg atggcaagca tcgagaagtc gatgccgtct tcgctgctac aggggcaaac      1140
     atcgacgcag tacctccatt cagcatcact gcacacggca aggatctgac cgaactctgg      1200
     tctgagggag gagaatacgg gtttccttac aactatattg gtattgcgac acccggcttc      1260
     cccaatctct tgttcatcct tgggcccaat ggcgcaggac gctcaggaac ggtaccgcac      1320
     aacgtagaag tgcaggtgac cctctttgcg aggattctta ggaaagtggg tcgagaaggc      1380
     atcaagacaa tccagccatc caaaaaggct gctgatgact ttgtgcagta ctcggatgcc      1440
     ttttggaaaa caacagtatt atctgaggac tgccagtcat ggtataatgg tgggaagccc      1500
     ggatcgcgaa tccacgggtt gtggcctgga agttcatccc tggtctctat catttataat      1560
     gatccaagat gggaagactg ggaatatgag tatcttaacg atactgggaa tcgtctagca      1620
     tggtattttg gtaacggagg taccaagatg gaggctgatc cggagcacga tattacctca      1680
     tacctgatag atccggctga gatagatttg aagaagcttc acgagggttg gtggagtgtc      1740
     ccttga                                                                 1746
//

If you have problems or comments...

PBIL Back to PBIL home page