(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE453

PENCW_13.PE453       Location/Qualifiers
FT   CDS_pept        1031399..1033051
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161421" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128955"
FT                   /orf_name="Pc16g04530"
FT                   /product="Pc16g04530 protein"
FT                   /function="transporter activity"
FT                   /biological_process="oligopeptide transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP93123.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0006857"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="UniParc:UPI00018317BA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8S1"
FT                   /transl_table=1
FT                   /translation="MTGLSGETDDPEPAIGSEKVEECGIESTAIKDNLLHESRKNEKDE
FT                   EILRKVAGPIPGSVWLVMLLTMAERFSFYGMTAPFMNFMQNSRDDPLHPGMLGWGQSRA
FT                   SAVSNVFFILGLLTPMGASLAADTSLGRYKVLCITFAFYLVGSVLLLVSSFPSSTRFAA
FT                   PVFLVSLVLIAVGISGVNGLMAAFVGDQYPIQDRPIILVKKGERVIVDRDRTLESIYNT
FT                   YYWSINMGGLSGLATTELELHIGFWAAYLLPTCALAFSAVILYVGRGRFTVVAAQSTAI
FT                   PNAARVMCLGARGGFSLDKSKASHLQRIHNRQVPWTDEFVEEVKRALAACRIMFAAWPI
FT                   LWICRGQASNNLVSQAAQMQSSGIPNDIMYNTNPIVIIICMPIVDRFLFPWLRRSGFAL
FT                   TAVTRLVWGFALEALTMAMAAIVQHLIYRSGPCYEYPLDCMASEGGTIPNSASIFLQLP
FT                   IFALEAFSEILSAPAGYELAFTMAPGSIKSVLQALFSTTGALGSSLSIALSPLYKDPNM
FT                   VIVYASLSIAMGVVTAMFYSIWGRKIKRTVVEK"
     atgactggct tgtcgggtga aacagatgac ccagagccgg ctattggttc agagaaggtg        60
     gaagagtgcg gtattgagag cactgcaatc aaggacaacc tgttgcacga gagcagaaaa       120
     aatgaaaagg acgaggaaat cttgcgcaag gtggctggtc cgatccctgg ctccgtttgg       180
     ctcgttatgc tactcactat ggccgagcgt ttctcatttt atggaatgac agcccccttc       240
     atgaatttta tgcaaaacag ccgcgacgac ccgctgcatc caggcatgct aggctggggt       300
     cagtcaagag cttcagcagt gtctaacgtt ttcttcatct tggggctgct aacgccaatg       360
     ggcgcgtcgc tcgcggcgga cacgtcccta ggtcgataca aggtcctgtg tatcaccttt       420
     gccttctacc ttgtaggctc tgtgttactt ctggtatcca gcttcccatc ttcaacaaga       480
     tttgctgcac ctgtcttcct tgtgtctctt gtgctgattg cggtgggtat atccggggtc       540
     aacggactca tggctgcctt tgttggcgac cagtacccca tccaagatag gcccatcatc       600
     ttggtcaaga aaggcgagcg cgttattgtt gatcgagatc gaactctaga gtctatttac       660
     aacacatatt actggagcat caatatgggc ggcctatcgg gcctggcgac cacagagctc       720
     gaattgcaca ttggcttctg ggccgcttat ctgctcccca catgcgctct ggccttttcg       780
     gcagtcatac tatacgtcgg gcgcggtcgc tttactgttg ttgctgcgca atccactgca       840
     attccgaatg cagcaagagt catgtgcctc ggagcccgcg gcggcttctc tctcgacaag       900
     agcaaggcgt ctcacctcca aagaatacac aatcgccaag tcccttggac tgacgaattt       960
     gttgaagaag tcaagagggc tctggcagct tgccgcataa tgttcgctgc ctggccgatc      1020
     ctgtggatct gtcgtggaca ggccagtaac aatcttgtct cgcaagccgc ccagatgcaa      1080
     agctcgggta tccctaacga catcatgtat aacaccaacc ccatcgttat cattatttgc      1140
     atgcccattg tcgaccgctt cctctttccc tggttacgac ggtccggctt tgccctcacc      1200
     gccgtcaccc gccttgtgtg gggtttcgcc cttgaggctc tcacgatggc catggcggcc      1260
     atcgtgcaac acctcattta tcgctcggga ccctgctatg agtacccact agactgcatg      1320
     gcatcggaag gggggaccat tcccaattcc gccagcattt tcttgcagtt acctatcttc      1380
     gccctggagg cattttccga gatactgtca gccccagctg gttatgagct ggcttttact      1440
     atggcaccag gcagtataaa aagtgttttg caggcattat ttagcaccac cggtgctttg      1500
     ggctcttctc tgagtattgc tctcagcccc ttgtacaagg accccaacat ggtcatagta      1560
     tatgcctccc tgtccattgc catgggtgta gtcactgcta tgttttatag tatatggggt      1620
     agaaagatta aacgcacggt tgttgagaaa tag                                   1653
//

If you have problems or comments...

PBIL Back to PBIL home page