(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE455

PENCW_13.PE455       Location/Qualifiers
FT   CDS_pept        complement(1039470..1040324)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824612"
FT                   /orf_name="Pc16g04550"
FT                   /product="Putative uncharacterized protein Pc16g04550 "
FT                   /protein_id="CAP93125.1"
FT                   /db_xref="UniParc:UPI00018317BC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8S3"
FT                   /transl_table=1
FT                   /translation="MASSTPLVKRSLSGQELPGDELLSSPAKRRRVNSANSAEKMPIET
FT                   TVASGGLRELMPRTTAETEVLVERTFSLRSVLEDDDLPIVCNCPPLRGRSDYRIWRRKM
FT                   RLILSRNLLLDLVDGKIGQLPQSHYLESQLDSLNEAARKIINTNLSATTRLIVRNIRNP
FT                   QKMWEKLEKHCKPSDWSLVRSGWLELQNIKYSQCCDIWEYVYKVDDAWRCICLDQEDTL
FT                   EKHEVARCTSLMCSLDTPKWETWKMGFLSSRDTNIPSWASLVESLTSAEDKGIVSDLIG
FT                   IAI"
     atggcctctt caacaccatt ggtgaaacga tccctctctg ggcaagagct cccgggagat        60
     gaactgctaa gctctcccgc aaaaaggcgc cgggtcaatt ccgctaattc cgccgagaaa       120
     atgcccattg agacaactgt tgcatccgga ggtctcagag aactcatgcc tcggacaact       180
     gcggaaacag aggtcctagt cgaacgtacc ttcagtttaa gaagtgtgct cgaggatgat       240
     gatttgccga tagtatgcaa ctgcccacca ttgcgcggcc gatccgacta ccgcatctgg       300
     cgccgcaaaa tgaggcttat tctgagccga aatctgcttt tggacttggt tgatggcaaa       360
     atcggtcaac tccctcaatc acactacttg gaaagtcaat tagacagtct gaacgaggcg       420
     gcgagaaaaa tcattaatac aaacctgtct gcgactacca ggctgattgt tcgcaatatt       480
     cgaaacccac agaagatgtg ggagaagctg gaaaaacact gcaaaccttc tgattggagc       540
     ttggtgcgat ctggctggct tgagctgcag aatatcaagt atagccagtg ttgtgacatc       600
     tgggagtatg tgtataaggt ggacgatgca tggaggtgca tctgccttga ccaggaggat       660
     actcttgaga agcacgaggt tgcccgttgt actagtctca tgtgctcttt ggatacaccg       720
     aagtgggaaa cttggaagat gggatttctt tctagtcgtg ataccaatat accgagctgg       780
     gcaagcctgg tggagagctt gacgtcagct gaggacaagg gcattgtgtc cgatcttatt       840
     ggtattgcaa tctga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page