(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE456

PENCW_13.PE456       Location/Qualifiers
FT   CDS_pept        join(complement(1043912..1043999),
FT                   complement(1043740..1043862),complement(1043613..1043692),
FT                   complement(1043214..1043532),complement(1042516..1043151),
FT                   complement(1041997..1042457))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204544" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948781"
FT                   /orf_name="Pc16g04560"
FT                   /product="Pc16g04560 protein"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP93126.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI00018317BD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8S4"
FT                   /transl_table=1
FT                   /translation="MSATINTRLPVGNKDFTNATVVIIGAGISGMCMAIDLIKRNKTQN
FT                   FVVLERSSSVGGTWNDNKYPGCCCDVFSSLYSYSFEQNPNWSREYPGQEEIHAYLVGVA
FT                   EKYGLYKHIRFNSTVEEARWDDTESKWRTSVVISGQKDSEFSSSYVLNSDFLVSAVGQL
FT                   NLPRAPDISGLADFQGKMMHSARWDWSYDMTGKRIAIIGNGATAAQIAPEVARVASHLT
FT                   IYQRTPNWVIPRLDQPVSTLQKTLFKWVPPLHWRKRALQMKFREDLFGAITDGDSELSH
FT                   MLRTLCTNAIKSQLPDRPDLWDSLTPSYAPGCKRIIITDDYYPTLARDNVHLETRGITC
FT                   VTDSGIKVDEEEQEHDLIVLATGFKTVEFMHPIRIYGTNGRPLEDIWRNGATALNGVTV
FT                   EDLPNFGMFYGPNTNLGHNSIILMIEAQSRYLNVLVGEVMQARQQGKTLALKPEPGALK
FT                   SYNDRIQAILRRTSFADPNCNSWYKRDDGVITNNWCGTVIDYQRELSKVQWQDYIAEGT
FT                   GKDRVMDKAATKVSHAQEEILLSNSSLLVGAIGILSATGYFVARSRRLKAH"
     atgtcagcga caattaacac acgtctccct gtgggaaaca aagacttcac caatgcaact        60
     gttgtcatta ttggtgctgg catatcgggg atgtgcatgg cgattgattt aatcaaacgg       120
     aacaaaactc agaattttgt tgtcctcgag agaagtagca gcgtgggtgg aacttggaat       180
     gacaacaagt atcccggctg ctgttgtgac gtcttcagct cgctgtatag ctattccttt       240
     gaacagaatc ctaattggtc aagagagtat cctggacagg aagagataca cgcgtatctc       300
     gttggagttg cagagaaata tggactctac aagcatattc gattcaactc cacagtggag       360
     gaggcccggt gggatgacac cgagtccaag tggaggacaa gcgttgtgat atcaggccag       420
     aaagacagcg agttctcaag ctcctacgtc ttgaattccg atttcctggt ctctgctgtc       480
     gggcaactca atttaccccg agcacctgac atctcaggcc tggcggattt tcaagggaag       540
     atgatgcact ccgctcggtg ggattggagt tatgacatga caggaaagcg gatcgcaatc       600
     attggcaacg gagcaactgc tgcccagatc gcccctgaag ttgctcgggt tgcatctcat       660
     ctcactatct atcagcggac gccaaactgg gtcattccac gcctagacca accagtatct       720
     acccttcaaa agaccctgtt caaatgggtt ccacccctcc actggcgcaa gcgagccctt       780
     caaatgaagt tccgtgaaga cctttttggc gctatcacag acggagattc ggaactttcc       840
     catatgcttc ggactttatg tacaaatgcg attaaatccc aactgcctga ccgaccagat       900
     ctgtgggact cgctgacacc cagttatgca ccgggatgca agcgaatcat cattacggat       960
     gattattatc ccactcttgc ccgtgacaat gtccacttgg agacacgggg catcacatgc      1020
     gttacagact ctggtatcaa ggtcgacgaa gaagagcaag aacacgacct tatcgttctt      1080
     gctacgggct tcaaaactgt ggaatttatg catcccatcc ggatttatgg cacaaatggt      1140
     cgacccttgg aggatatctg gagaaatgga gcaacggcat tgaacggtgt gacagtggag      1200
     gacttgccca actttggaat gttctatggt cccaacacaa atctggggca caactccatc      1260
     atcctcatga tcgaagcaca gtcacgatat ctgaacgtcc tagttgggga agtaatgcaa      1320
     gcccgccaac aaggtaagac actggctctc aagccagagc cgggtgcgtt gaaaagctac      1380
     aacgacagga tccaagctat tctacggcgt accagcttcg cggatccaaa ttgcaacagc      1440
     tggtataaga gagatgacgg ggtgattacc aataattggt gtgggactgt gattgattac      1500
     caacgtgaac tttcgaaggt gcagtggcag gactatattg ccgagggaac tggtaaagac      1560
     cgtgtcatgg acaaggctgc tacgaaagtg agtcatgctc aggaagagat attgttaagc      1620
     aattcttcat tgcttgttgg ggctattggt attttatcag cgacaggtta ctttgtggct      1680
     cggtctagac gacttaaggc acactga                                          1707
//

If you have problems or comments...

PBIL Back to PBIL home page