(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE457

PENCW_13.PE457       Location/Qualifiers
FT   CDS_pept        join(complement(1045434..1045485),
FT                   complement(1045355..1045380),complement(1045129..1045257),
FT                   complement(1044917..1045039),complement(1044528..1044857),
FT                   complement(1044409..1044462))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158359" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948782"
FT                   /orf_name="Pc16g04570"
FT                   /product="Pc16g04570 protein"
FT                   /protein_id="CAP93127.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI00018317BE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H904"
FT                   /transl_table=1
FT                   /translation="MDSDQKFALHEAAREGRNEVVESLLNANPKSAFVKDDDERLPIHW
FT                   AAAYNRVPVVELLVAMKDFDPDVEDGSGWTPLMIAASLKDAAGDATIDLLLRKGAGVSI
FT                   KSNSGQNALHFASSKANISTVRTLLANKCSARVKDRRGQLPLHRAAAVGSVPILKTLLE
FT                   EGKSPVNATDGDGFTALHHAISEGHGPAAILLLKSGAEAEKRDSEGRLAIELVPDDKVK
FT                   QYILQTAEREGIELP"
     atggattccg atcagaagtt cgccctgcac gaggctgccc gagaaggaag aaacgaggtt        60
     gttgagtcgt tgctcaatgc aaacccaaaa tccgcgttcg tgaaggatga tgatgagcgt       120
     cttccaatcc actgggctgc ggcctacaac cgagtcccgg ttgtggaatt gctagtcgct       180
     atgaaggatt tcgacccaga cgtagaagat ggatccggtt ggacgcctct catgattgca       240
     gctagcctaa aagatgccgc aggcgacgcg actatcgact tattactgcg aaaaggagct       300
     ggtgtctcta tcaaaagtaa ctccggacag aatgcgctgc acttcgcaag ttccaaagcc       360
     aatatttcca ccgtccgcac cctgcttgcc aataaatgta gtgctagagt caaggacaga       420
     cgtggtcaac ttcctcttca cagagcagcc gcagtgggat ctgtgcctat cttgaagacc       480
     ctcttggaag agggtaagag ccctgtcaac gcaacggatg gggacggatt cacggcactt       540
     caccacgcta tctctgaggg tcatggacct gccgcaatct tattgttgaa gtctggagcg       600
     gaagcggaaa agagagacag tgaaggtaga ctggcaattg agctagtccc agatgacaag       660
     gtcaagcaat acatcttaca gacagcagag agagaaggga ttgaactccc ttga             714
//

If you have problems or comments...

PBIL Back to PBIL home page