(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE458

PENCW_13.PE458       Location/Qualifiers
FT   CDS_pept        1046246..1047604
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207595" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128956"
FT                   /orf_name="Pc16g04580"
FT                   /product="Pc16g04580 protein"
FT                   /protein_id="CAP93128.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00018317BF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y8"
FT                   /transl_table=1
FT                   /translation="MEYNSPQSADDAVRMSAKRTAELFGTEYLMVTPTTLTDSSIGVSY
FT                   RRKAEYADITELPRALAEKQAKATAGRTKRPKIQAQAPADGSGSSMSLVRRPSGAGAGA
FT                   GVAGGDQPKSLIQRPSATKQQRPEWHAPWKLMRVISGHLGWVRSLAVEPNNQWFASGAG
FT                   DRTIKIWNLATGALRLTLTGHISTVRGLAVSPRHPYLFSCGEDKMVKCWDLETNKVIRH
FT                   YHGHLSGVYTLALHPRLDLLVTGGRDGVCRVWDMRTRSNIHVLSGHKGTVADIKCQDAD
FT                   PQIISGSLDSTVRLWDLAAGKSMGVLTHHKKGVRNLAIHPTEFTFASASTGSIKQWMCP
FT                   KGDFMQNFEGQNSVINSLAVNDENVLFSGGDDGSMSFWDWKTGHRFQSMETTAQPGSLE
FT                   AEAGVMASTFDRTGLRLITGEADKTIKIWKQDEQATPETHPLTWAPTLGRQRY"
     atggaataca attcacccca gtccgctgat gacgccgtgc gcatgtccgc aaagcggact        60
     gccgaactct ttggtaccga atacctgatg gtcacaccca caactcttac agacagctca       120
     atcggcgttt cctaccgacg gaaggcggaa tacgcagata ttaccgagct ccccagagct       180
     ctcgcagaga aacaggcgaa ggctacagca ggccgaacga aacgaccgaa gattcaggca       240
     caggcacccg cagacggcag tggctcatcc atgtcacttg tgaggcggcc atcgggcgct       300
     ggagcgggag cgggcgtagc aggtggagac caacctaaga gtctgatcca gagaccgtcg       360
     gccaccaagc aacagcggcc cgagtggcac gcgccttgga agctgatgcg cgttatttcg       420
     ggacacttag gatgggtgcg gtctttagca gtggaaccga acaaccagtg gtttgccagt       480
     ggagcaggag atcggacaat caagatttgg aatctggcga cgggcgcatt gcgactcact       540
     ctcaccggtc acatctccac cgtccgtggc ttagcagtgt caccccggca tccgtacctt       600
     ttctcgtgcg gtgaggataa gatggtcaag tgttgggatc tggaaaccaa taaggtcatt       660
     cgtcactacc acggtcatct tagcggtgtg tacacactgg cccttcaccc tcgtctcgat       720
     ctgttagtca cgggtggtcg tgatggtgtg tgccgagttt gggatatgcg gacgcgaagc       780
     aacatacacg ttctcagcgg acacaaaggc actgttgccg atatcaagtg ccaagacgcc       840
     gaccctcaga ttatctcagg atcgctggac tccacagtcc ggttgtggga tttggccgcc       900
     ggtaagagca tgggtgtctt gacgcaccac aagaagggtg ttcgcaacct ggccatccac       960
     cccaccgagt tcacgtttgc cagtgccagt accggtagca tcaagcagtg gatgtgcccc      1020
     aagggcgatt tcatgcaaaa cttcgagggc cagaactcgg taatcaactc tctcgccgtc      1080
     aacgacgaga acgttctctt ctccggtggt gacgacggtt ccatgtcctt ctgggactgg      1140
     aagactggtc atcgcttcca atctatggaa actactgcac agcccggctc tcttgaagcc      1200
     gaagccggcg tcatggcttc tacctttgat cgtactggtt tgcgtcttat cactggcgaa      1260
     gctgataaga ccatcaagat ctggaagcag gacgaacaag ctacccccga gactcaccct      1320
     ttgacttggg ccccgactct cggtagacag cggtactag                             1359
//

If you have problems or comments...

PBIL Back to PBIL home page