(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE459

PENCW_13.PE459       Location/Qualifiers
FT   CDS_pept        join(complement(1049721..1050494),
FT                   complement(1049544..1049665),complement(1048977..1049489),
FT                   complement(1048022..1048802))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207574" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824613"
FT                   /orf_name="Pc16g04590"
FT                   /product="Pc16g04590 protein"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="origin recognition complex "
FT                   /protein_id="CAP93129.1"
FT                   /db_xref="GO:0000808"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="InterPro:IPR001025"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR020793"
FT                   /db_xref="UniParc:UPI00018317C0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y9"
FT                   /transl_table=1
FT                   /translation="MSDSDSESSPQRRSARERAQWMTKGALVRDDSDDELGVEDLPWNW
FT                   IYDTNEETTQETENNDDTPAKRSRRRSSRPARKKRKIVGAQMGQFQCKVGDVILLKSPE
FT                   AGKDWVGIVTEFLEEDDEDEEDEIVKSANIMWFASPDEFMGTRNKRRTDALPNEQYITL
FT                   DFNSNPLTSISGKGTVMSQSAFNAKYPNGPPKNKTELAEYHKCIVCRRGVNQVQGRYTE
FT                   EFIWEQVYDEDNIHNLINWVRDGLKASRKRKVADDEYVDTKETTVPTTPRKRQRLAATN
FT                   ATPQSQRKKSLMTPTHKRIVVKKPLEFTPLGTRVLSPTHFDSPYRQARNLLHVSTVPDS
FT                   LPCRKTEFNTVYNHLSAAIMEGTGACIYISGTPGTGKTATVREVVAQLNAAVHEEEMDD
FT                   FIFVEINGMKVTDPHQSYSLLWEALKGDRVSPSHALDLLEREFSNPSPRRVSCVVLMDE
FT                   LDQLVTKNQSVITRLANVPGNIVDPDAVQFASRKVAAVSGDARRALDICRRAVEIAEQA
FT                   ADEAAAADEAKDETESLPPTPSKTPARRNNAIAAKEAGTSAVAKPPAKGQPGRVTIATI
FT                   KQAIHEATSTPLQQSLRCLPLSGKLFLAALLARVHRTGISESTFGDVLDEARRIADAAV
FT                   AVAGAAGAGVKDFLLGGGPSARVRSLGHAAMSLMNSGVLALEQGSGSKSVLGGTTIPTR
FT                   GDRSSKVRLRVAAEDVRSAFREDAEAKGFGLGIER"
     atgagcgata gcgattcaga atcttcgcct cagaggcgca gcgcccgtga gcgcgcccaa        60
     tggatgacca agggagctct ggttcgagac gactccgatg atgagctagg tgtcgaggac       120
     cttccgtgga actggattta cgacacaaac gaagagacta ctcaggaaac agagaacaac       180
     gatgataccc cggcgaaacg tagtcgaaga cggtcctccc gtcccgcccg caaaaaacgc       240
     aaaattgttg gtgcacagat gggtcaattc caatgcaaag tgggcgatgt gattcttcta       300
     aaatcccccg aagctggaaa ggactgggtt ggcatcgtta cggagttttt ggaagaggac       360
     gacgaggacg aagaagacga gattgtcaaa tctgccaata ttatgtggtt cgcatccccc       420
     gacgaattca tgggcacgag gaacaagcgc cggaccgacg ccttgcccaa cgaacagtac       480
     atcacactcg atttcaatag caaccccttg acttcaatca gcggcaaagg gacggtcatg       540
     tctcagagcg ccttcaatgc taaatacccg aatgggcctc caaagaacaa gaccgaattg       600
     gcggaatacc acaagtgcat tgtttgtcga cgaggcgtga accaggttca aggacggtat       660
     accgaagagt ttatctggga gcaggtgtac gatgaagaca atatccacaa tctgatcaat       720
     tgggtcaggg atggcttgaa ggcttccaga aaacgcaagg tagcggatga tgaatatgtc       780
     gacaccaaag agaccacggt acctacgacg ccgagaaaga ggcagcgact agcagccacg       840
     aatgccacgc cacaatcaca gcgcaagaag tccctaatga ctcccaccca caaacggatt       900
     gtcgtgaaaa agccactcga gtttaccccg ctgggcaccc gtgtcctctc acccacgcat       960
     ttcgactctc cctaccgtca agctcggaac ttgctacatg tctccactgt tccagactca      1020
     ttgccgtgcc gaaagaccga gttcaacact gtatacaacc accttagtgc tgcgatcatg      1080
     gaaggcacag gcgcctgtat ctatatctcc ggtaccccag gcactggcaa gactgccacg      1140
     gtacgcgagg tggttgcaca gctaaacgct gccgtgcatg aagaagagat ggacgatttc      1200
     atctttgtcg agattaacgg catgaaagtc accgacccgc atcaatccta ctccttacta      1260
     tgggaagcct tgaagggcga ccgagtctca ccttcccatg cattggatct tctcgaaaga      1320
     gaattctcaa atccctcccc tcgtcgggtc tcttgtgttg tgctcatgga tgaactggat      1380
     caacttgtca caaagaatca gtccgtcatc actcgcttgg caaatgtacc gggtaacatc      1440
     gttgatccag acgccgtcca attcgcaagc cgcaaagtcg ccgccgtcag cggtgatgct      1500
     cgacgagctt tggatatctg tcgacgagct gttgaaatcg ccgaacaagc agccgacgag      1560
     gctgctgccg cagatgaggc caaagacgag acagaatcat tgcctcccac gcccagcaaa      1620
     acccccgctc ggcgcaataa tgctatcgca gccaaagaag ccgggacatc agccgtggct      1680
     aaacctcctg cgaagggcca accggggcgc gttactatcg ccactatcaa gcaagccatt      1740
     cacgaagcta catcaacccc actccagcaa tccttgcgct gcctcccgct atcaggaaag      1800
     ctcttcctcg ccgccctgct agctcgcgtc caccggactg gcatttcaga atctacattc      1860
     ggcgacgtcc tcgatgaagc ccgtcgcatc gccgatgcag ccgtcgccgt tgctggagcc      1920
     gctggtgccg gagtcaaaga tttcttgctg ggtggaggcc ccagtgctcg cgtgcggagc      1980
     ctaggccatg cggccatgtc gctcatgaac tcgggtgtcc tggcgctgga gcaaggctct      2040
     ggctctaaaa gcgtgctcgg gggtactaca attcccactc gcggcgatcg cagtagtaaa      2100
     gttcgtctta gggttgcggc ggaagacgtg aggtcggctt tcagggagga tgctgaggct      2160
     aaaggctttg gtttgggcat tgagcggtga                                       2190
//

If you have problems or comments...

PBIL Back to PBIL home page