(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE46

PENCW_13.PE46        Location/Qualifiers
FT   CDS_pept        join(101051..101171,101481..101532,101633..101659,
FT                   101996..102197,102685..102882)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945523"
FT                   /orf_name="Pc16g00460"
FT                   /product="Putative uncharacterized protein Pc16g00460 "
FT                   /protein_id="CAP92716.1"
FT                   /db_xref="UniParc:UPI0001831156"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V7"
FT                   /transl_table=1
FT                   /translation="MTWISTYPGDLRWLVLTCCIGVKGMPSPWFMPAYARQGKGVGILM
FT                   GFGFLKEENSRTGRKKLAQLVRLSVGRLALVPGGSAEWLPLSLSTCTACILNGVITPTR
FT                   SLFDFENIEHGQQSRQVFSARIITLSAAYGAWLDFALAFVFVICPGLAVPPTVPPYSLA
FT                   FALAHDQNPAPLLQLKVRELNKVLRHAKLGHLYPLA"
     atgacttgga tatctactta ccctggggat ttaagatggt tagtgcttac ttgctgcatc        60
     ggagttaaag gaatgccaag cccgtggttt atgccggctt atgcccgaca ggggaaaggc       120
     gttggaatat tgatgggttt cggtttcctc aaggaagaaa acagccggac cgggaggaag       180
     aagcttgccc agctggtcag attgtctgta ggtcgcctag cactggttcc tggaggatct       240
     gctgagtggc ttccactttc cctctcaacc tgcacagcat gcattctcaa tggagtcatc       300
     actcctacga ggtctctctt tgatttcgag aatatcgaac atggtcaaca gtctcgacag       360
     gtgttctccg cgagaatcat caccctttcg gcagcttatg gcgcttggct tgatttcgct       420
     ctcgcattcg ttttcgttat ctgtcccggt ctcgctgttc cccctaccgt tcctccctac       480
     agtctcgctt tcgctctcgc tcacgaccag aacccagcac cattactgca gctaaaagtc       540
     cgagaactta ataaagttct ccgccatgca aagctaggcc atttgtatcc cttggcatga       600
//

If you have problems or comments...

PBIL Back to PBIL home page