(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE460

PENCW_13.PE460       Location/Qualifiers
FT   CDS_pept        join(1051730..1051761,1051818..1051840,1051892..1052470,
FT                   1052519..1052561,1052617..1052719,1052746..1053006,
FT                   1053080..1053666,1053723..1054013,1054069..1054672)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948783"
FT                   /orf_name="Pc16g04600"
FT                   /product="Pc16g04600 protein"
FT                   /protein_id="CAP93130.1"
FT                   /db_xref="UniParc:UPI00018317C1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Z0"
FT                   /transl_table=1
FT                   /translation="MAALPESYETDWERINAKSWELPNYGPGPDFSGGTIYRQDDNEHA
FT                   YKTSPDHDDEGGFEDANYGSPPVNYPPRPPTSTVPVTGRSLPSVPPPPTRRPIPNQSVL
FT                   PTQAVITGARTSQAQAPEGPILNERGPNTSNSNTLAPQPHHASRNPRSGQRTPRRGAHT
FT                   DTPRARFQSKKGSSASAQSQHRAKNPPNAPGQNDSYSKAKWRKGLSPDASYRLPYECQV
FT                   FQEKIRQVTSGEASNIDFRQRIIEETDAYVRISAGNAKIREAQYTDNAKLLHIWGRQNQ
FT                   VLAAQNLLQDMLNQLMQQGTSAKAPSRWTKIHAHSNTKVAHARTRESHQERLSEMRKPP
FT                   KIATDYTLGFLWPPDGPSLNYFVTARRELLDFIRLKYDVNIYIKPGIPDYLFMSGNNER
FT                   DMCIIASRFRELWERLMVQHETEIKLFLVAAPRAEVMRTHVLLQKSGGLSTPVICGPEL
FT                   APEVAANWKTTADEIKLSNKNMVTTRLRKALHVIPQFRGFLQMRAKFGSFALQQWRKPK
FT                   DGTSYEFSEFREMLTHMNTEGRLLPGIRLQQDEIFNRIIESTFLKPWGKAKIKSLLSLM
FT                   PRYSANFEYQVNNESVIRVEAKFSLPVGSQEFEVNGIRCFKSKQIGAPVDRQMPMQISM
FT                   IDFERSDWQLEVKALELCPENEIPPDLDKFMRSIGFQWNANAKSIGSAPKRKARFSYGS
FT                   PIKRFVEKATIQLQVKDSPHVFELARFDEYTYAAGQWSMNPKVSWGASLFNPDWDDILG
FT                   EQADIKVLDTSKDACLSVFFPPPGDGEERTEKQKTDDELRKEAEIRKVEEEKQLGLFMS
FT                   TVQQVARMLGNPGAEMPDVLETDLGSLF"
     atggcggctc tacctgaatc ctacgagacg gactgggagc gtatcaacgc caaatcatgg        60
     gaactgccta actacggccc cggtccagac tttagcgggg gaaccatcta tcgccaggac       120
     gataacgagc acgcatataa gacgagtccg gatcatgatg atgagggtgg cttcgaagat       180
     gcgaactatg gttcccctcc agttaactat ccgccgcgcc ccccgacttc tacagtgccc       240
     gtaactggtc gatccctccc aagtgtgcct cctccgccca cacgacgacc tattccgaac       300
     caaagcgtcc ttccaaccca ggcagtcatc actggggcca gaacaagtca agctcaggca       360
     ccggaggggc caatcttgaa cgagcgtggg cctaacacca gcaattccaa tacgttagca       420
     ccacagccgc atcatgcgtc gcgtaatccc agatcaggcc aacgcacccc tcgcaggggg       480
     gctcatactg acacaccacg agcacggttt cagtcaaaga aaggcagttc tgcttcggct       540
     cagtcgcaac acagagctaa gaatccacct aacgcaccag ggcaaaatga ctcttattcc       600
     aaggcaaagt ggcgcaaagg cctttctcca gatgcttctt atcgtttacc ttacgagtgt       660
     caagtgttcc aagaaaagat tcggcaagtg acttctgggg aagcttccaa catcgacttt       720
     cgccagagga tcatcgagga gacagatgcc tatgtgagga taagtgcggg aaatgccaaa       780
     attcgggagg ctcaatatac tgataacgca aagttgcttc acatctgggg ccgacaaaat       840
     caggttttgg cggcccagaa tctgcttcag gatatgttga atcagttaat gcagcagggg       900
     acatcggcta aggcaccatc gcgttggacc aagatacacg cacattcgaa tacgaaagtt       960
     gcccatgccc ggacacggga aagccaccag gaaagattgt ccgagatgcg aaagccaccg      1020
     aaaattgcta cggactacac gcttggcttc ctctggcccc cggacggccc gtcactgaac      1080
     tactttgtta ctgctcgacg cgagctcctc gatttcattc gcttgaaata tgacgtgaac      1140
     atctacatca agcctggtat cccagactac cttttcatgt ctggaaataa tgagcgggat      1200
     atgtgcatca ttgcatctcg gttccgagag ctgtgggaga ggctgatggt ccagcacgag      1260
     acggaaatca agctgttcct tgttgcggcg ccccgggcag aggttatgag aactcatgta      1320
     ctcctgcaga agtctggtgg gctttcgaca cctgtcatct gtggaccgga actggcccca      1380
     gaggtggccg caaactggaa gaccactgcg gatgagatca agctcagcaa taagaacatg      1440
     gtcaccaccc gcctgaggaa agcactgcat gtgattcctc aattccgggg attcctgcaa      1500
     atgcgagcaa agttcggttc attcgcgttg caacagtggc gcaagccgaa agatggcact      1560
     tcctatgagt tctcggagtt tcgcgagatg cttacccata tgaacaccga gggacgtttg      1620
     ctcccaggaa tccggttgca gcaagatgag atcttcaacc gaatcataga atcaaccttc      1680
     cttaagccct ggggtaaagc caagatcaaa tcgctgctga gcctgatgcc tagatattcc      1740
     gccaactttg agtaccaagt gaacaatgag tcggtgatcc gcgtggaagc gaaattctct      1800
     cttcctgttg gctcacagga gtttgaagtc aacggaatcc gttgtttcaa atcaaagcaa      1860
     attggtgctc ctgttgatcg ccaaatgcca atgcagatca gcatgatcga cttcgaaagg      1920
     tccgactggc aactcgaagt gaaggctctt gaactttgcc ccgaaaatga gatccccccg      1980
     gatctagaca aatttatgcg ttcgattggt ttccaatgga acgcaaacgc aaagagcatt      2040
     ggatctgccc ccaagcgcaa ggcgaggttc tcctatggtt cgccaatcaa gcgcttcgtc      2100
     gaaaaggcca caattcagct ccaagtcaaa gactcgccgc atgtattcga actcgcccgc      2160
     ttcgacgagt acacgtacgc ggctggtcaa tggtcgatga acccaaaagt gtcctggggt      2220
     gcatcattgt tcaatcctga ctgggacgat atactgggtg aacaggctga tatcaaggtc      2280
     ctcgacacat ccaaagatgc gtgtctatcg gtgttctttc ccccaccggg ggatggtgag      2340
     gagcggacgg agaagcagaa gaccgacgac gagctccgca aggaagccga aatccgaaag      2400
     gtggaagagg agaagcagct gggccttttc atgagcactg tccagcaggt tgcgcggatg      2460
     ctggggaatc caggtgctga gatgccagat gttcttgaga ctgatctcgg aagtctgttc      2520
     tag                                                                    2523
//

If you have problems or comments...

PBIL Back to PBIL home page