(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE461

PENCW_13.PE461       Location/Qualifiers
FT   CDS_pept        join(complement(1055770..1055806),
FT                   complement(1055382..1055668),complement(1055199..1055316),
FT                   complement(1055050..1055102))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207562" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128957"
FT                   /orf_name="Pc16g04610"
FT                   /product="Pc16g04610 protein"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="prefoldin complex"
FT                   /protein_id="CAP93131.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0016272"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR004127"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR011599"
FT                   /db_xref="UniParc:UPI00018317C2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Z1"
FT                   /transl_table=1
FT                   /translation="MSQNTDGAPQGSINLASLSVPQLRALQTRLTSELEHLTTSHTKLR
FT                   AAQAKFRDCVRSINDGVTGNAKKGTDGRDEILVPLTSSLYVKGRLTDREKVLVDVGTGF
FT                   YVEKTAPKAVAFYDEKVKGLDANLQELEKIVQTKSSQLRIVEETLRQKMLSEGAPQAAA
FT                   G"
     atgtcacaaa acacagatgg agctccccaa ggctcaatca acctcgcctc tctttctgtt        60
     cctcagctcc gcgccctcca aacccgtctc acctccgaat tggaacacct gaccacctcg       120
     cacacgaagc tgcgcgccgc ccaagccaag ttccgtgatt gtgtgcgctc aatcaatgat       180
     ggcgtgactg ggaacgcgaa gaagggaacc gatggccgcg atgagatcct cgtgcccctc       240
     accagttcgc tgtacgtcaa gggccgcttg acggatcgcg agaaggtgct tgttgatgtc       300
     ggaactggat tctatgttga gaagactgcg cctaaggcgg ttgcgttcta tgatgagaag       360
     gtcaagggct tggacgcgaa cttgcaggag ttggagaaga tcgtacagac caagagctcg       420
     caattgcgca ttgtggaaga gacattgagg cagaagatgc tctcagaggg tgctcctcag       480
     gctgctgcgg gctaa                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page