(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE462

PENCW_13.PE462       Location/Qualifiers
FT   CDS_pept        join(1056266..1056441,1056544..1057229,1057284..1057692,
FT                   1057751..1058039,1058089..1058481)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234999" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671907"
FT                   /orf_name="Pc16g04620"
FT                   /product="Pc16g04620 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP93132.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00018317C3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Z2"
FT                   /transl_table=1
FT                   /translation="MASRLAACEACRKAKVACDHKRPACTRCASNDRAGICIYRTTPFK
FT                   RRRVSSSTPVQSPRSNPYPNPGFLGSSSHVAIFNEISPQDYHASDTYHASEDMTMLMQS
FT                   QSTGENILLIQGADVLRQLLNTFPLAAMKDFVTFWLATGANLALAEPFTEKCTENMTRL
FT                   FTSFSQEDNWHLAYAQRLTQNSREPLQFNSTSDMESFSAQFLDQKFRWESLGIFLSAVT
FT                   RAAIDISFFPPLFKTEKDQFMLRKLSTKLSDLALDIALSLDCLNDLQLVLQYENCIVHT
FT                   HVDGDQSYHSWSRLGDVVSSMFALGYHENVDKTKPPIPIFLAELRKTAWATTYSADKNI
FT                   AIFLGRPPRMSKRFCHFQVPLSPTSSDQVSNTSHVEDEVVRWKTDTPICYRSGIRWATL
FT                   CSALKEDVLELLRSKQRDNFSQKASIIRQKAETQWAHLPPHFHLSGSLKECSGDAFERD
FT                   LLASIRLDQLHVLFLLQLSFLDTLTEPDSSILDISDQMLSLVVDAILLRDQLVNSGTGL
FT                   VWKIAHFGLPAAGIILLSMLKQHRTLTEARSSWSKTILNLGIFVAQVQVGSIVRRGDPN
FT                   YALVSKATQTIERFLDSIHREGIQSPTQPPPHLGENGDWASFFSQDLCDFETDFWENLA
FT                   YHPSLLASDPTLPAI"
     atggcttcca gactggcagc atgtgaagct tgcagaaaag caaaagttgc ctgtgatcat        60
     aaaagaccag catgtactcg atgtgcaagt aacgatagag ctggaatatg catctaccga       120
     acaacgccgt tcaagagaag aagagtgtcg agctctacac ctgtgcagtc tcctaggagt       180
     aatccctatc caaaccccgg cttcctgggg tcctccagcc atgtcgctat tttcaacgaa       240
     atttccccgc aagactatca tgcatccgat acctaccatg cctccgagga catgacgatg       300
     ctcatgcagt cgcagtctac tggcgagaat attttgttaa tccaaggcgc ggatgtcctc       360
     aggcagctgc taaacacatt tcctctagcc gccatgaagg attttgttac tttttggctg       420
     gcaacaggtg caaatctagc tctagcagag ccttttaccg agaagtgcac tgaaaacatg       480
     acgcgcctat tcacgtcctt ctcacaggaa gacaattggc atttggcata cgcccaacgt       540
     ctaacacaaa attcccggga acctttgcag tttaacagca cttcagatat ggaaagtttc       600
     tctgcccagt tcctcgatca gaaattccga tgggaaagtc taggtatctt cctctctgct       660
     gtgacccgag cagcgatcga tatatcattt ttcccgccat tgttcaaaac cgaaaaggac       720
     caattcatgc ttcggaagct atctacaaaa ttgagcgatc tcgcattaga tattgcgctc       780
     tccctggatt gcttgaacga cctacaactg gttctacagt atgagaactg tattgtacat       840
     acccatgttg acggggacca aagctatcat tcgtggagta ggcttggaga cgttgtgtcg       900
     tccatgtttg cactcggcta ccatgagaat gtcgacaaaa ccaagccacc aattccgatt       960
     ttccttgcgg aattgcgaaa gacagcttgg gccaccacat actccgccga caagaatatt      1020
     gctatattcc ttggtcggcc acctcggatg agcaagcggt tctgtcactt tcaagtgcct      1080
     ttatcaccaa caagttcgga tcaggtttcg aacacttcac acgttgagga cgaggtcgtc      1140
     agatggaaaa cagatacacc catttgctat aggtcaggta ttcggtgggc gaccctttgc      1200
     tccgcactga aagaagacgt cctcgaattg cttcgatcaa agcagcgcga caatttcagc      1260
     cagaaagcta gcatcattcg gcagaaagcc gaaactcaat gggcacacct accccctcac      1320
     ttccaccttt cgggctcttt gaaagaatgc tctggagatg cattcgaacg cgacctccta      1380
     gctagcatac gtctggacca actacatgtt ctcttcctac ttcaattgtc gtttctcgat      1440
     accctgaccg agcccgattc atctatactc gacatctcgg atcaaatgct ctctcttgta      1500
     gtggacgcga ttcttttacg agatcaactg gtcaactctg gaactggact cgtttggaag      1560
     atcgcccact tcggcctccc ggctgcaggg attattctcc tttcaatgct gaaacaacat      1620
     cgcacattaa ccgaagcgag atcctcatgg tccaaaacaa tactaaatct cggtatattt      1680
     gttgcgcagg tacaggtagg gagcatcgtt cggcgtggag atccgaacta cgccttggta      1740
     tccaaagcga cacagacgat tgaacggttc cttgattcaa ttcaccgcga aggaatacaa      1800
     tccccgacgc aaccgccacc gcatctagga gagaatggtg attgggcttc atttttcagc      1860
     caggatctgt gcgatttcga gactgacttt tgggagaacc tcgcgtatca tccttctttg      1920
     ttggcttccg accctacttt gcctgccatc tag                                   1953
//

If you have problems or comments...

PBIL Back to PBIL home page