(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE463

PENCW_13.PE463       Location/Qualifiers
FT   CDS_pept        complement(1059392..1061068)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948784"
FT                   /orf_name="Pc16g04630"
FT                   /product="Pc16g04630 protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity, acting on CH-OH group
FT                   of donors"
FT                   /biological_process="alcohol metabolic process "
FT                   /protein_id="CAP93133.1"
FT                   /db_xref="GO:0006066"
FT                   /db_xref="GO:0016614"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="UniParc:UPI00018317C4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Z3"
FT                   /transl_table=1
FT                   /translation="MNSLILSLFFISAAASQSYLPSEQIDVQSSLLSDPNQVAGKTVDY
FT                   IIAGGGLTGLTVAAKLTENPNITVLVIENGFYESADGAIIEDLNAYGDIFRTTVDHAYE
FT                   TVPHAINNRTENIRSGNGLGGSTLINGGSWTRPHKAQIDSWERVFGNKGWNWDYLFPYM
FT                   QKVETSRPPNDVEIAAGHYYDSACHGTNGTVHSGFRNTGEVYSPIIKAFMNSSEERGVP
FT                   TKLDFHCGVPRGVSMIPNSLHKDQTRSDAAREWLLPNYKRPNLQVLTGQFVGKVLINQT
FT                   TISGHKTGHKAVGVNFGTNKHVNFNVYAKHEVLLAAGSAVSPRILEYSGIGLKPVLDAA
FT                   GVQQIVDLPVGLNMQDQTTTTVASRTKPSGNGQGQAIYYATFNETFGDFAPQAHHLLNT
FT                   KLHQWASETVARGGFHNVTALEIQYQNYRDWLNDEVVMTDLMEAPSPPGTGIDVSAPTI
FT                   ERESRKRSRDDDGEQDDPSSPPQKKQSEWANFTTLSDSSSGGDQPEPDADGDIPMDDET
FT                   YKPYKIANTSGETDSSVWSTMRGYLGLTGRGSTPPEQPEEL"
     atgaactcct taattctatc attgtttttt atctccgcgg ctgcatccca gagctacctg        60
     ccctctgagc agatcgatgt tcagtccagt cttctttctg atccgaacca agtcgctggt       120
     aagacagttg actatataat tgccgggggt ggtttgacag gcctgactgt tgcagccaag       180
     ctgactgaga accccaacat cacggtcctg gtcattgaaa acggcttcta tgagtccgcc       240
     gatggagcca tcattgagga tctgaatgcc tacggagaca tttttcgcac caccgtcgac       300
     catgcctacg aaaccgttcc tcacgcaatt aataaccgca ctgaaaacat tcgatctggc       360
     aatggtcttg gaggatcaac tttgatcaat ggtggctctt ggacacgccc ccataaagcc       420
     cagatcgact cctgggagag ggtatttgga aacaagggtt ggaactggga ttacctgttc       480
     ccatatatgc agaaggtcga aacctctcgt cctccaaatg atgtcgagat tgccgctggt       540
     cattactatg attctgcctg tcatggaacg aacggcactg ttcattctgg tttccgtaac       600
     accggagagg tctattctcc aataatcaag gcctttatga attcttccga ggaacgtggt       660
     gtcccgacca aactagactt tcactgtgga gtccctcgcg gtgtttctat gattcccaat       720
     tcgctgcaca aagaccagac tcgctcggac gctgcacgtg aatggcttct gccaaactac       780
     aaacgcccga atctgcaggt tctgacgggt cagtttgttg gaaaggtcct tatcaatcaa       840
     accaccattt ctggtcacaa aaccggtcac aaagctgttg gtgtaaactt cggcaccaac       900
     aaacatgtga atttcaacgt atacgccaag cacgaggtat tgctagcagc cggctctgct       960
     gtctcgcccc ggattctgga atactcaggt attggcttga agcctgtact cgatgccgct      1020
     ggtgtccagc aaattgttga tcttcctgtc ggtctcaaca tgcaggacca aaccaccact      1080
     accgtggcct cccgtaccaa gccctccggc aatggtcaag gccaggctat ctattacgcc      1140
     actttcaatg agacatttgg agatttcgct cctcaggctc accacttgct taacaccaag      1200
     ttgcaccagt gggccagcga gactgttgcg cgtggtggtt tccataatgt gactgccctt      1260
     gagatccagt accagaacta ccgcgattgg ctgaatgatg aagtcgttat gaccgatctt      1320
     atggaagctc catctccgcc tggcaccggc atagatgttt ctgcacctac tattgaacgt      1380
     gagagtcgca agcggtctag ggatgatgat ggtgagcaag atgacccgtc ttccccgcca      1440
     caaaagaagc agtccgagtg ggcaaacttt actactctaa gtgactcttc ttcaggtggc      1500
     gatcaaccag agccggatgc tgatggcgat atcccgatgg atgatgaaac gtataagcct      1560
     tataagattg cgaatacgtc tggtgaaaca gatagtagcg tgtggtctac tatgagagga      1620
     tatctcggtc ttacgggccg cggatctact ccaccggagc aacctgagga gctctag         1677
//

If you have problems or comments...

PBIL Back to PBIL home page