(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE464

PENCW_13.PE464       Location/Qualifiers
FT   CDS_pept        1062598..1064040
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076672" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948785"
FT                   /orf_name="Pc16g04640"
FT                   /product="Pc16g04640 protein"
FT                   /function="D-arabinono-1,4-lactone oxidase activity "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP93134.1"
FT                   /db_xref="GO:0003885"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="UniParc:UPI00018317C5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Z4"
FT                   /transl_table=1
FT                   /translation="MLSPKPAFLLLLLHAVFGSAYRWFNWQLEVTCQSDAYIAPHNEHA
FT                   AAEFLKEQYPKGSHIKVVGNGHGFGNLTTCVDNALTEKPTYIVSLTNLKKLHIDKKNLT
FT                   VTFGAGWDVDDLIQELKANDLSFSNLGVERVQNFVGAASTGTHGSGSDLGNIATQIIGL
FT                   RVLDSQGGLRVINEKHNAEELKAFRISLGALGLITELTIKVQPTQLLKKTTKVLNATSD
FT                   YSKMYNELAQLYKEHDRMTVWGPHFDWNAKSQSWDLEPTYFLSYWEPTNYTGVRNCTLN
FT                   HCANGCGDCKKEYICYDEVTDAASCSPQGVCSRGFYAEIEHFLPIEYFAEAATNYTIFQ
FT                   QGQTSRMKAPYNKQMVMQHRSLKGDDTYLSPVNTYNLGPDLSGVFGVIEIDWIQEYNNF
FT                   TTLWQNQELAHEFLPQFGETYNARSHWNKMSAPNATYTLEKFPKLPEFLAIQKRQDPKC
FT                   QFVNEFLVEQLGITRCANYISV"
     atgctgagcc ctaagccggc tttcctgctg ttgctgctgc acgcagtgtt cggctcggcc        60
     taccgctggt tcaactggca gcttgaggtc acttgccagt ctgatgccta tattgctcct       120
     cataatgagc atgccgccgc cgagttcctc aaggaacagt accctaaggg ctcccatatc       180
     aaagttgttg ggaatggtca tggatttggt aacctcacta cctgtgtcga caatgctctc       240
     actgagaagc ccacctacat cgtttctctc accaacctga agaagctcca tatcgataag       300
     aagaacttga ccgtcacctt tggtgccggc tgggatgtcg atgaccttat ccaagagctc       360
     aaggccaacg acttgtcctt cagcaatctc ggtgttgagc gtgttcagaa ctttgtgggt       420
     gctgcctcca caggtaccca cggttctgga tccgacctcg ggaatatcgc aacccagatt       480
     atcgggctgc gtgtattgga ctcacaggga ggcctgcgtg tcatcaacga gaagcacaat       540
     gcggaagaat tgaaggcttt ccgtatcagt cttggtgccc tcggtttaat cacggagttg       600
     actatcaagg tccagcctac ccaactcctg aagaagacca ccaaggtctt gaatgccacg       660
     tccgactatt caaagatgta caatgagctt gcccagctgt acaaggagca cgaccgcatg       720
     actgtctggg gtcctcactt cgactggaat gcaaagtctc agagctggga ccttgagcct       780
     acttacttcc tctcttactg ggagccaacc aactacaccg gtgttcgcaa ctgcaccctc       840
     aatcactgcg ccaacggctg cggtgactgc aagaaggagt acatttgcta cgacgaagtc       900
     actgatgcgg cgtcctgctc tcctcaaggt gtctgttccc ggggcttcta cgccgagatc       960
     gagcacttcc ttcctataga atatttcgcg gaagccgcca ccaactacac tattttccaa      1020
     cagggccaga cgtctcgcat gaaggcaccc tacaacaagc agatggtcat gcagcaccgt      1080
     tcgctcaagg gtgatgatac atacttgtcc ccagttaaca cctacaacct tggcccagac      1140
     cttagcggtg tttttggagt catcgagatt gactggatcc aagaatacaa caacttcacc      1200
     actctctggc agaaccagga actggcccat gaattcctcc ctcagtttgg tgaaacctac      1260
     aacgctcgct cgcactggaa caagatgagc gctcctaatg ccacttatac cctggagaaa      1320
     ttccccaagc tgccagagtt cttggccatc cagaagcgtc aggaccccaa gtgccagttc      1380
     gttaacgaat tcctggttga gcagcttgga attacgcgct gtgcaaacta tatctctgta      1440
     taa                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page